ESTScan Details for Unigene SGN-U333764

Score 
683
Direction 
Forward
Predicted Peptide Sequence 
GGGSSRARRQRRGEDVXPPAQGFFRGSLQWDIKEAFTISQCVVLKVSIRQLGPSMIQQMQHPCNECKGTGEMISDKDRCPQCKGEKVVQE
KKVLEVHVEKGMQNGQKVTFPGEADEAPDTITGDIVFVLQQKEHPKFKRKGDDLFVEHTLTLTEALCGFQFVLTHLDNRQLLIKSQPGEV
VKPDQFKAINDEGMPMYQRPFMRSKMYIHFTVDFPESLTAEQCRNLEAVLPPKPKLQVSDMGXKPMLGDYFAPVNIGVKSKGTTSFPEAF
EQKDDFPGGAQKIQCPSIIWDLPFWKX
Predicted Coding Sequence 
GGTGGTGGAAGCAGCAGAGCTCGTAGACAAAGAAGAGGAGAGGATGTTXATCCACCCGCTCAAGGTTTCTTTAGAGGATCTTTACAATGG
GACATCAAAGAAGCTTTCACTATCTCGCAATGTGTTGTGCTCAAAGTTTCTATCAGACAGCTCGGTCCATCCATGATCCAGCAGATGCAG
CACCCTTGCAATGAGTGTAAGGGTACTGGTGAGATGATCAGTGACAAAGATAGGTGCCCTCAGTGTAAGGGTGAGAAGGTTGTGCAGGAG
AAGAAGGTGTTGGAAGTTCACGTGGAGAAGGGTATGCAGAATGGGCAGAAAGTAACATTTCCAGGCGAGGCAGATGAAGCGCCAGATACC
ATCACTGGAGACATTGTTTTTGTCTTGCAACAAAAGGAACATCCTAAGTTCAAGCGAAAGGGAGATGATCTTTTTGTTGAGCACACATTG
ACCTTGACTGAGGCCCTATGTGGTTTCCAGTTTGTCTTGACTCACCTAGACAACAGACAGCTGCTCATTAAGTCCCAACCTGGCGAAGTT
GTCAAGCCTGATCAGTTTAAGGCTATCAACGATGAAGGAATGCCGATGTACCAAAGGCCGTTCATGAGAAGTAAAATGTACATTCACTTC
ACTGTTGATTTCCCCGAGTCATTAACAGCAGAACAGTGCAGGAACCTTGAGGCTGTGCTGCCTCCCAAACCCAAATTGCAGGTATCTGAT
ATGGGAATXAAACCAATGTTAGGAGACTACTTTGCACCAGTGAACATTGGGGTTAAATCCAAAGGAACCACAAGCTTCCCAGAGGCCTTT
GAACAAAAAGATGATTTCCCGGGGGGTGCACAGAAAATCCAATGTCCCAGCATAATTTGGGATTTGCCTTTCTGGAAAGXX
Edits in Original Sequence 
GGGTGGTGGAAGCAGCAGAGCTCGTAGACAAAGAAGAGGAGAGGATGTTATCCACCCGCTCAAGGTTTCTTTAGAGGATCTTTACAATGG
GACATCAAAGAAGCTTTC
(5')GGTGGTGGAAGCAGCAGAGCTCGTAGACAAAGAAGAGGAGAGGATGTTXATCCACCCGCTCAAGGTTT
CTTTAGAGGATCTTTACAATGGGACATCAAAGAAGCTTTCACTATCTCGCAATGTGTTGTGCTCAAAGTTTCTATCAGACAGCTCGGTCC
ATCCATGATCCAGCAGATGCAGCACCCTTGCAATGAGTGTAAGGGTACTGGTGAGATGATCAGTGACAAAGATAGGTGCCCTCAGTGTAA
GGGTGAGAAGGTTGTGCAGGAGAAGAAGGTGTTGGAAGTTCACGTGGAGAAGGGTATGCAGAATGGGCAGAAAGTAACATTTCCAGGCGA
GGCAGATGAAGCGCCAGATACCATCACTGGAGACATTGTTTTTGTCTTGCAACAAAAGGAACATCCTAAGTTCAAGCGAAAGGGAGATGA
TCTTTTTGTTGAGCACACATTGACCTTGACTGAGGCCCTATGTGGTTTCCAGTTTGTCTTGACTCACCTAGACAACAGACAGCTGCTCAT
TAAGTCCCAACCTGGCGAAGTTGTCAAGCCTGATCAGTTTAAGGCTATCAACGATGAAGGAATGCCGATGTACCAAAGGCCGTTCATGAG
AAGTAAAATGTACATTCACTTCACTGTTGATTTCCCCGAGTCATTAACAGCAGAACAGTGCAGGAACCTTGAGGCTGTGCTGCCTCCCAA
ACCCAAATTGCAGGTATCTGATATGGGAATXAAACCAATGTTAGGAGACTACTTTGCACCAtGTGAACATTGGGGTTAAATCCAAAGGAA
CCACAAGCTTCCCAGAGGCCTTTGAACAAAAAGATGATTTCCCGGGGGGTGCACAGAAAATCCAATGTCCCAGCATAATTTGGGATTTGC
CTTTCTGGAAAGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan