ESTScan Details for Unigene SGN-U333771

Score 
393
Direction 
Forward
Predicted Peptide Sequence 
LTAFKXLITPRTDRGGLRSRTRGSPGLQASIVSIDXILTDRKMFGRAPKNSDNTKYYEILGVPKAASQEDLKKAYRKAAIKNHPDKGGDP
EKFKELAQAYEDLSDPEKREIYDQYGEDALEDVIHPLKVSLEDLYNGTSKKLSLSRNVLSSKCMGEGSKPGASMKCSGCQGSGMKVSIRQ
LGPSMIQQMQHPCNECKGTGEMISDKDRRPQCKGEKVVQEKKGVEVSRLEGDATMAESNIFQARADETARYPSPGXPLVFVLEQKENILX
GSILKGARKLFDXKATFDPRTAAPKLGSQVC
Predicted Coding Sequence 
XCTTTGACGGCCTTTAAAANCTTGATTACCCCTCGAACTGACCGCGGNGGTTTACGATCTAGAACTCGCGGATCCCCCGGGCTGCAGGCT
TCAATCGTTTCTATTGACGXTATTTTAACAGATCGAAAGATGTTTGGAAGAGCACCGAAGAATAGCGATAATACAAAGTATTATGAGATC
TTAGGAGTTCCTAAGGCTGCTTCTCAGGAAGATCTCAAAAAGGCTTATCGTAAAGCTGCTATCAAAAATCACCCTGATAAGGGAGGCGAT
CCTGAGAAGTTTAAAGAGCTTGCTCAAGCTTATGAGGACTTGAGTGACCCGGAGAAGCGTGAGATATATGATCAGTATGGAGAGGATGCT
CTAGAGGATGTTATCCACCCGCTCAAGGTTTCTTTAGAGGATCTTTACAATGGGACATCAAAGAAGCTTTCACTATCTCGCAATGTGCTG
AGCTCAAAGTGCATGGGTGAAGGGTCCAAGCCAGGTGCTTCAATGAAATGTTCTGGCTGTCAAGGGTCTGGAATGAAAGTTTCTATCAGA
CAGCTCGGTCCATCCATGATCCAGCAGATGCAGCACCCTTGCAATGAGTGTAAGGGTACTGGTGAGATGATCAGCGACAAAGATAGGCGC
CCTCAGTGTAAGGGTGAGAAGGTTGTGCAGGAGAAGAAAGGGGTGGAAGTCTCACGTTTAGAAGGGGATGCCACAATGGCAGAAAGTAAC
ATTTTCCAGGCTAGGGCAGATGAAACCGCCAGATACCCATCACCTGGAGXACCATTGGTGTTTGTCTTGGAACAAAAAGAGAACATTCTT
AAXGGTTCAATCCTAAAAGGCGCGAGGAAGCTTTTTGATXTAAAGGCCACATTTGATCCTCGGACTGCAGCCCCTAAGTTGGGCTCCCAA
GTTTGT
Edits in Original Sequence 
(5')XCTTTGACGGCCTTTAAAANCTTGATTACCCCTCGAACTGACCGCGGNGGTTTACGATCTAGAACTCGCGGATCCCCCGGGCTGCA
GGCTTCAATCGTTTCTATTGACGXTATTTTAACAGATCGAAAGATGTTTGGAAGAGCACCGAAGAATAGCGATAATACAAAGTATTATGA
GATCTTAGGAGTTCCTAAGGCTGCTTCTCAGGAAGATCTCAAAAAGGCTTATCGTAAAGCTGCTATCAAAAATCACCCTGATAAGGGAGG
CGATCCTGAGAAGTTTAAAGAGCTTGCTCAAGCTTATGAGGACTTGAGTGACCCGGAGAAGCGTGAGATATATGATCAGTATGGAGAGGA
TGCTCTAGAGGATGTTATCCACCCGCTCAAGGTTTCTTTAGAGGATCTTTACAATGGGACATCAAAGAAGCTTTCACTATCTCGCAATGT
GCTGAGCTCAAAGTGCATGGGTGAAGGGTCCAAGCCAGGTGCTTCAATGAAATGTTCTGGCTGTCAAGGGTCTGGAATGAAAGTTTCTAT
CAGACAGCTCGGTCCATCCATGATCCAGCAGATGCAGCACCCTTGCAATGAGTGTAAGGGTACTGGTGAGATGATCAGCGACAAAGATAG
GCGCCCTCAGTGTAAGGGTGAGAAGGTTGTGCAGGAGAAGAAAGGGGTGGAAGTCTCACGTTTAGAAGGGGATGCCACAATGGtCAGAAA
GTAACATTTTCCAGGCTAGGGCAGATGAAACCGCCAGATACCCATCACCTGGAGXACCATTGGTGTTTGTCTTGGAACAAAAAGAGAACA
TTCTTAAXGGTTCAATCCTAAAAGGCGCGAGGAAGCTTTTTGATXTAAAGGCCACATTTGATCCTCGGACTGCAgGCCCCTAAGTTGGGC
TCCCAAGTTTGT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan