ESTScan Details for Unigene SGN-U333798

Score 
356
Direction 
Forward
Predicted Peptide Sequence 
KAGAHRGGGRSRTSGSPGLQAPIGGGRRLNRGQTWVINAPRGTKMARIWGRTGCNFNAAGRGTCQTGDCGGVLQCTGWGKPPNTLAEYAL
DQFSNLDFWDISLVDGFNIPMTFAPTKPSGGKCHAIHCTANINGECPRALKVPGGCNNPCTTFGGQQYCCTQGPCGPTELSKFFKKRCPD
AYSYPQDDPTSTFTAPGGSTNYRVVFCPNGCADPXIPLEMPASTDEXGQVKLXVLILIASLVN
Predicted Coding Sequence 
AAAGCTGGAGCTCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGCTCCGATAGGCGGTGGTCGACGTCTCAAT
CGAGGCCAAACATGGGTCATCAATGCTCCGAGGGGAACTAAGATGGCACGTATATGGGGTCGTACTGGTTGCAACTTTAATGCTGCAGGC
AGAGGTACATGTCAGACTGGTGATTGTGGTGGAGTCTTACAGTGTACCGGATGGGGCAAACCCCCAAACACCCTAGCCGAGTACGCCTTG
GACCAGTTTAGCAACTTAGATTTTTGGGACATTTCTTTAGTCGATGGATTTAATATTCCAATGACTTTTGCCCCAACAAAACCTAGTGGA
GGAAAATGTCACGCAATTCATTGCACGGCCAATATAAATGGTGAATGTCCTCGCGCCCTTAAGGTACCTGGAGGATGTAACAACCCTTGT
ACCACGTTTGGAGGACAACAATATTGTTGCACCCAAGGTCCATGTGGCCCTACAGAGTTGTCCAAATTTTTCAAGAAAAGATGTCCCGAT
GCTTATAGCTACCCACAAGACGATCCTACAAGCACATTTACTGCCCCTGGTGGTAGTACAAACTATAGGGTTGTCTTTTGTCCTAATGGG
TGTGCTGATCCXCNAATTCCCCTTGAGATGCCTGCAAGTACTGATGAAGXTGGCCAAGTGAAATTGNNAGTTCTCATTTTAATCGCCTCA
TTAGTCAACTGA
Edits in Original Sequence 
(5')AAAGCTGGAGCTCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGCTCCGATAGGCGGTGGTCGACGTCT
CAATCGAGGCCAAACATGGGTCATCAATGCTCCGAGGGGAACTAAGATGGCACGTATATGGGGTCGTACTGGTTGCAACTTTAATGCTGC
AGGCAGAGGTACATGTCAGACTGGTGATTGTGGTGGAGTCTTACAGTGTACCGGATGGGGCAAACCCCCAAACACCCTAGCCGAGTACGC
CTTGGACCAGTTTAGCAACTTAGATTTTTGGGACATTTCTTTAGTCGATGGATTTAATATTCCAATGACTTTTGCCCCAACAAAACCTAG
TGGAGGAAAATGTCACGCAATTCATTGCACGGCCAATATAAATGGTGAATGTCCTCGCGCCCTTAAGGTACCTGGAGGATGTAACAACCC
TTGTACCACGTTTGGAGGACAACAATATTGTTGCACCCAAGGTCCATGTGGCCCTACAGAGTTGTCCAAATTTTTCAAGAAAAGATGTCC
CGATGCTTATAGCTACCCACAAGACGATCCTACAAGCACATTTACtTGCCCCTGGTGGTAGTACAAACTATAGGGTTGTCTTTTGTCCTA
ATGGGTGTGCTGATCCXCNAATTCCCCTTGAGATGCCTGCAAGTACTGATGAAGXTGGCCAAGTGAAATTGNNAGTTCTCATTTTAATCG
CCTCATTAGTCAACTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan