ESTScan Details for Unigene SGN-U333814

Score 
936
Direction 
Forward
Predicted Peptide Sequence 
MASACASSTIAAVAFSSPSSRRNGSIVGTTKASFLGGRRLRVSKYSTTPTAXKCNYSGVAADPDSLPGDFGFDPLGLASDPESLRWNQQA
ELVHCRWAMLGAAGIFIPELLTKIGILNTPSWYTAGEQEYFTDTTTLFIVELVLIGWAEGRRWADIIKPGCVNTDPIFPNNKLTGTDVGY
PGGLWFDPLGWGSGSPAKIKELRTKEIKNGRLAMLAVMGAWFQHIYTGTGPIDNLFAHLADPGHATIFAAFIPSEKQKQNTFCCNDV
Predicted Coding Sequence 
ATGGCCTCAGCTTGTGCTTCATCCACCATTGCTGCTGTTGCTTTTTCTTCTCCAAGTTCGAGGAGAAATGGATCAATTGTAGGAACAACA
AAAGCTTCATTCCTTGGAGGAAGAAGATTGAGAGTAAGCAAATACAGTACTACACCTACAGCACXGAAGTGCAACTACAGTGGCGTTGCT
GCAGACCCTGACAGCCTTCCCGGAGACTTCGGTTTCGATCCTCTTGGTCTAGCATCTGATCCAGAGAGCTTGAGATGGAACCAACAGGCA
GAACTTGTACACTGCAGATGGGCAATGTTGGGAGCTGCAGGAATTTTCATTCCAGAATTACTCACAAAAATTGGAATACTTAACACACCT
TCATGGTACACTGCTGGTGAACAAGAATATTTCACGGACACAACGACTCTCTTCATCGTTGAATTGGTACTTATTGGTTGGGCTGAGGGA
AGAAGATGGGCAGATATCATCAAGCCTGGATGCGTTAACACGGATCCAATCTTCCCTAACAACAAGCTCACGGGGACAGATGTTGGTTAT
CCAGGAGGTTTATGGTTTGATCCCTTGGGTTGGGGTTCGGGTTCACCTGCAAAGATAAAGGAGTTGAGGACAAAGGAGATTAAGAACGGT
AGACTTGCTATGTTAGCCGTTATGGGTGCATGGTTCCAACACATTTACACTGGAACAGGCCCTATTGATAACCTATTTGCTCACCTAGCT
GATCCTGGTCATGCCACTATTTTTGCTGCATTCATCCCAAGTGAGAAGCAGAAGCAGAACACCTTTTGTTGTAATGATGTGTAA
Edits in Original Sequence 
GCATACAAGAGTGAAGAATTTGCCGACATGGCCTCAGCTTGTGCTTCATCCACCATTGCTGCTGTTGCTTTTTCTTCTCCAAGTTCGAGG
AG
(5')ATGGCCTCAGCTTGTGCTTCATCCACCATTGCTGCTGTTGCTTTTTCTTCTCCAAGTTCGAGGAGAAATGGATCAATTGTAGGA
ACAACAAAAGCTTCATTCCTTGGAGGAAGAAGATTGAGAGTAAGCAAATACAGTACTACACCTACAGCACXGAAGTGCAACTACAGTGtG
CGTTGCTGCAGACCCTGACAGCCTTCCCGGAGACTTCGGTTTCGATCCTCTTGGTCTAGCATCTGATCCAGAGAGCTTGAGATGGAACCA
ACAGGCAGAACTTGTACACTGCAGATGGGCAATGTTGGGAGCTGCAGGAATTTTCATTCCAGAATTACTCACAAAAATTGGAATACTTAA
CACACCTTCATGGTACACTGCTGGTGAACAAGAATATTTCACGGACACAACGACTCTCTTCATCGTTGAATTGGTACTTATTGGTTGGGC
TGAGGGAAGAAGATGGGCAGATATCATCAAGCCTGGATGCGTTAACACGGATCCAATCTTCCCTAACAACAAGCTCACGGGGACAGATGT
TGGTTATCCAGGAGGTTTATGGTTTGATCCCTTGGGTTGGGGTTCGGGTTCACCTGCAAAGATAAAGGAGTTGAGGACAAAGGAGATTAA
GAACGGTAGACTTGCTATGTTAGCCGTTATGGGTGCATGGTTCCAACACATTTACACTGGAACAGGCCCTATTGATAACCTATTTGCTCA
CCTAGCTGATCCTGGTCATGCCACTATTTTTGCTGCATTCAgTCCCAAGTGAGAAGCAGAAGCAGAACACCTTTTGTTGTAATGATGTGT
AA(3')TATACCTACATTGGGTTTGCCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan