ESTScan Details for Unigene SGN-U333819

Score 
-491
Direction 
Forward
Predicted Peptide Sequence 
TIHWPSFYNVVTGKTLALPNXNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLKFALIFVKSAHFLTNRPKSAKSLINQ
KNKPEIGLSVVPVWNKSPLLKNVDSNVKGRKTVYQGDGPLREPXTLIKFFGVEVPKALNGTLKGAPDLELDGEKPAKRGEKGRGRKRKGA
GARAAGQVVTSPLARNQPHPAGALMPPLPGARSGGTFFRX
Predicted Coding Sequence 
ACAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTXAATCGCCTTGCAGCACATCCCCCTTTC
GCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCAAATTGTAAGCGTT
AATATTTTGTTAAAATTCGCGTTAATTTTTGTTAAATCAGCTCATTTTTTAACCAATAGGCCGAAATCGGCAAAATCCCTTATAAATCAA
AAGAATAAACCXGAGATAGGGTTGAGTGTTGTTCCAGTTTGGAACAAGAGTCCACTATTAAAGAACGTGGACTCCAACGTCAAAGGGCGA
AAAACCGTCTATCAGGGCGATGGCCCACTACGTGAACCAXTCACCCTAATCAAGTTTTTTGGGGTCGAGGTGCCTAAAGCACTAAATGGA
ACCCTAAAGGGAGCCCCCGATTTAGAGCTTGACGGGGAAAAGCCGGCGAAACGTGGCGAGAAAGGAAGGGGAAGAAAGCGAAAGGGAGCG
GGCGCTAGGGCXGCTGGGCAAGTGGTAACGTCACCGCTTGCCCGTAACCAACCACACCCCGCCGGCGCTTTAATGCCCCCCCTTCCAGGG
GCGCGTTCAGGGGGGACATTTTTTCGGGXX
Edits in Original Sequence 
TCATTAAAATCTAGGAAGGAGGAAGCTGCATCCAACTTTCCCTTGAGGAGTAATACTCTGCAAATTAATGATTAATATCTCAAGTGTAGA
ATCAATTTTCTGAACTCATTTCTGTTCTTGATTTGAGGAATTAGCCTTTGGGAATTTTGTATGTTAAAAGATTGAAAACTGCAGATTATG
AGAGATTAGCAATAATATTTGCATAATTCACTTTTAAAAAAAAAAAAAAAAAAAA
(5')ACAATTCACTGGCCGTCGTTTTACAACGTCG
TGACTGGGAAAACCCTGGCGTTACCCAACTTXAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCA
CCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCAAATTGTAAGCGTTAATATTTTGTTAAAATTCGCGTTaAATTTTT
GTTAAATCAGCTCATTTTTTAACCAATAGGCCGAAATCGGCAAAATCCCTTATAAATCAAAAGAATAAACCXGAGATAGGGTTGAGTGTT
GTTCCAGTTTGGAACAAGAGTCCACTATTAAAGAACGTGGACTCCAACGTCAAAGGGCGAAAAACCGTCTATCAGGGCGATGGCCCACTA
CGTGAACCAXTCACCCTAATCAAGTTTTTTGGGGTCGAGGTGCCgTAAAGCACTAAATcGGAACCCTAAAGGGAGCCCCCGATTTAGAGC
TTGACGGGGAAAAGCCGGCGAAACGTGGCGAGAAAGGAAGGGGAAGAAAGCGAAAGGGAGCGGGCGCTAGGGCXGCTGGGCAAGTGGTAA
CGTCACCGCTTGCCCGTAACCAACCACACCCCGCCGGCGCTTTAATGCCCCCCCTTCCAGGGGCGCGTTCAGGGGGGACATTTTTTCGGG
XX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan