ESTScan Details for Unigene SGN-U333837

Score 
113
Direction 
Reverse
Predicted Peptide Sequence 
MEXVGGSIASEAVERSIRKPPLLAGWPGFLKAVWQAGFRFGKAGQWSAAAINGSLLHSLGTPGFYILCFPACILGGIVADNNFTQETVMT
MITPSLKLTLNKGNKSWSSTAVAAALELVDPPGCRETYSVTLSEKGTYTFYCAPLQGGGMVGKVTVK
Predicted Coding Sequence 
ATGGAGCXGGTAGGGGGTTCAATTGCGAGTGAAGCGGTAGAGCGCTCAATACGCAAACCGCCTCTCCTCGCGGGTTGGCCXGGATTCTTG
AAGGCAGTTTGGCAGGCAGGTTTCCGGTTTGGGAAAGCGGGGCAGTGGAGTGCAGCGGCAATTAATGGGAGTTTGCTTCATTCATTAGGC
ACCCCAGGCTTTTACATTTTATGTTTTCCGGCTTGTATATTGGGTGGAATTGTGGCGGATAACAATTTCACACAGGAAACAGTTATGACC
ATGATTACGCCAAGCTTGAAATTAACCCTCAATAAAGGGAACAAAAGCTGGAGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGAT
CCCCCGGGCTGCAGGGAGACATACAGTGTCACTTTGAGTGAGAAAGGAACTTACACTTTCTACTGTGCACCTCTCCAGGGAGGTGGAATG
GTTGGCAAAGTTACTGTCAAATAA
Edits in Original Sequence 
GAGACATACAGTGTCACTTTGAGTGAGAAAGGAACTTACACTTTCTACTGTGCACCTCTCCAGGGAGGTGGAATGGTTGGCAAAGTTACT
GTCAAATAATTTTTTTCACACCTTTGTTTTGTAAAAGTTGATTGGAGTTCCCATCAATTTAAACATTTTCCTTTTAGTATTGCCCT
(5')
ATGGAGCXGGTAGGGGGTTCAATTGCGAGTGAAGCGGTAGAGCGCTCAATACGCAAACCGCCTCTCCTCGCGGGTTGGCCXGGATTCTTG
AAGGCAGTTTGGCAcGGCAGGTTTCCGGTTTGGGAAAGCGGGGCAGTGGAGTGCAGCGGCAATTAATGGGAGTTTGCTTCATTCATTAGG
CACCCCAGGCTTTTACATTTTATGTTTTCCGGCTTGTATATTGGGTGGAATTGTgGGCGGATAACAATTTCACACAGGAAACAGTTATGA
CCATGATTACGCCAAGCTTGAAATTAACCCTCAATAAAGGGAACAAAAGCTGGAGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAGTGG
ATCCCCCGGGCTGCAGGGAGACATACAGTGTCACTTTGAGTGAGAAAGGAACTTACACTTTCTACTGTGCACCTCTCCAGGGAGGTGGAA
TGGTTGGCAAAGTTACTGTCAAATAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan