ESTScan Details for Unigene SGN-U333840

Score 
276
Direction 
Forward
Predicted Peptide Sequence 
MNNKWGFVLSTLLAITLTISANGEDPYLLHEWKDAYGTLSTLGVPQKVILINGQFPGPIINGTSNNTCDENVYNQLDEPLSFTWSGXPTN
EKLMAGRNPXVTIDPSLPVLISLIVAKSMIKSVVTITTLSHAXHRADGGYGELVDLKSFDPVHGNPDAXPLVLAGDRIPEHPKFKDVDID
PTVATGCIM
Predicted Coding Sequence 
ATGAATAACAAGTGGGGTTTTGTGCTATCAACTTTGTTAGCAATAACCTTGACCATTTCAGCAAATGGAGAGGATCCTTATCTGTTGCAT
GAATGGAAAGATGCATATGGCACCCTTTCTACACTTGGTGTACCTCAAAAAGTCATATTAATCAACGGTCAATTCCCTGGCCCTATAATT
AATGGAACATCAAATAATACATGTGATGAGAATGTGTATAATCAATTAGACGAACCACTTTCGTTCACATGGAGTGGTXATCCAACAAAC
GAAAAACTCATGGCAGGAAGGAACCCTXATGTAACAATTGACCCATCCCTCCCGGTACTAATTTCACTTATCGTTGCCAAGTCAATGATC
AAATCAGTAGTTACTATAACTACTCTATCACATGCACXGCATCGTGCTGATGGAGGATATGGTGAACTAGTGGACCTAAAAAGCTTTGAT
CCTGTACATGGAAACCCCGACGCTGXACCATTGGTCCTGGCCGGGGATAGGATTCCAGAGCACCCCAAATTTAAGGATGTTGATATCGAC
CCCACTGTAGCCACGGGTTGTATAATGTAA
Edits in Original Sequence 
TCCTTTTTTTTTGTCCTCTCAGGTGCTCTTTTTGGTTTTTTCGATTCGATCAAAACAAAGTTTTAAAGAATCGAAAAACCATATGAAACA
CGAGAGAGAAAAGTTTTCATAAATAAAAAAAATGAATAACAAGTGGGGTTTTGTGCTATCAACTTTGTTAGCAATAACCTTGACCATTTC
AGCAAATGGAGAGGATCCTTATCTGTTGCATGAATGGAAAGATGCATAT
(5')ATGAATAACAAGTGGGGTTTTGTGCTATCAACTTTGT
TAGCAATAACCTTGACCATTTCAGCAAATGGAGAGGATCCTTATCTGTTGCATGAATGGAAAGATGCATATGGCACCCTTTCTACACTTG
GTGTACCTCAAAAAGTCATATTAATCAACGGTCAATTCCCTGGCCCTATAATTAATGGAACATCAAATAATACATGTGATGAGAATGTGT
ATAATCAATTAGACGAACCACTTTCGTTCACATGGAGTGGTXATCCAACAAACGAAAAACTCATGGCAGGAAGGAACCCTXATGTAACAA
TTGACCCATCCCTCCCGGTACTAATTTCACTTATCGTTGCCAAGTCAATGATCAAATCAGTAGTTACTATAACTACTCTATCACATGCAC
XGCATCGTGCTGATGGAGGATATGGTGAACTAGTGGACCTAAAAAGCTTTGATCCTGTACATGcGAAACCCCGACGCTGXACCATTGGTC
CTGGCCGGGGATAGGATTCCAGAGCACCCCAAATTTAAGGATGTTGATATCGACCCCtACTGTAGCCACGGGTTGTATAATGTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan