ESTScan Details for Unigene SGN-U333861

Score 
474
Direction 
Forward
Predicted Peptide Sequence 
MASNTLMSCGIPAVCPSFLSSTKSKFAAAMPVSVGATNSMSRFSMSADWMPGQPRPSYLDGSAPXVSSXYFLRFILCDMMYDDLIRYLSC
CILKLDNLIXCRDFGFDPLGLGEVPANLERYKESELIHCKWAMLAVXKLLFPYHNIYTLYILNILNEICFFAIFVAGIIVPEALGLGNWV
KAQEWAAIPGGQATYLGQPVPWGTLPTILAIEFLAIAFVEHQRSMEKDSEKKKYPGGAFDPLGYSKDPAKFEELKVKEIKKVKILTPPSS
YYIYGFKVYMLNIIISNXLVIRASLVVGIGGNFVYNNHHYPGTGTIGKIWQLPLGGPW
Predicted Coding Sequence 
ATGGCTTCTAATACATTGATGAGTTGTGGAATTCCAGCTGTTTGCCCCTCTTTCCTCTCTTCTACCAAGTCCAAATTCGCCGCCGCGATG
CCGGTGTCCGTTGGAGCTACCAACTCCATGTCTCGGTTCTCCATGTCAGCTGATTGGATGCCCGGGCAGCCCCGTCCATCTTACCTCGAC
GGCTCAGCCCCCGXGGTAAGTAGTXACTACTTCCTTCGTTTCATTTTATGTGATATGATGTATGATGATCTCATACGATATTTAAGTTGT
TGTATATTAAAGTTGGATAACTTAATATAATGCAGAGATTTTGGATTTGATCCACTTGGTTTAGGAGAAGTACCTGCAAATTTGGAAAGA
TACAAAGAATCTGAACTTATTCATTGCAAATGGGCTATGCTTGCTGTTGXTAAGCTTCTTTTTCCTTACCATAACATATATACGTTATAT
ATTTTGAACATTCTTAACGAAATTTGTTTCTTCGCAATTTTTGTAGCCGGAATCATAGTACCAGAGGCATTGGGCTTAGGTAATTGGGTC
AAGGCCCAAGAATGGGCAGCCATTCCTGGTGGACAAGCTACATATTTGGGCCAGCCTGTTCCATGGGGAACACTTCCTACTATTTTGGCT
ATTGAATTTCTAGCCATAGCTTTTGTAGAACACCAAAGGAGTATGGAAAAAGATTCAGAAAAGAAGAAGTACCCTGGTGGGGCTTTTGAC
CCATTGGGCTACTCTAAAGACCCTGCTAAATTTGAAGAACTCAAAGTCAAGGAAATCAAGAAGGTTAAAATATTAACTCCTCCTTCCTCT
TATTATATTTATGGATTTAAGGTATATATGCTGAACATTATCATCTCGAATAAXTTGGTGATTAGGGCGTCCTTGGTTGTTGGAATTGGT
GGGAATTTTGTGTACAACAATCACCATTATCCXGGAACAGGAACCATTGGAAAAATTTGGCAACTTCCCTTGGGTGGACCCTGG
Edits in Original Sequence 
GCTTTTAATTACCAAAAAAAAAAGAGGAAGAAGATATGGCTTCTAATACATTGATGAGTTGTGGAATTCCAGCTGTTTGCCCCTCTTTCC
TCTCT
(5')ATGGCTTCTAATACATTGATGAGTTGTGGAATTCCAGCTGTTTGCCCCTCTTTCCTCTCTTCTACCAAGTCCAAATTCGCC
GCCGCGATGCCGGTGTCCGTTGGAGCTACCAACTCCATGTCTCGGTTCTCCATGTCAGCTGATTGGATGCCCGGGCAGCCCCGTCCATCT
TACCTCGACGGCTCAGCCCCCGXGGTAAGTAGTXACTACTTCCTTCGTTTCATTTTATGTGATATGATGTATGtATGATCTCATACGATA
TTTAAGTTGTTaGTATATTAAAGTTGGATAACTTAATATaAATGCAGAGATTTTGGATTTGATCCACTTGGTTTAGGAGAAGTACCTGCA
AATTTGGAAAGATACAAAGAATCTGAACTTATTCATTGCAAATGGGCTATGCTTGCTGTTGXTAAGCTTCTTTTTCCTTACCATAACATA
TATACGTTATATATTTTGAACATTCTTAACGAAATTTGTTTCTTCGCAATTTTTGTAGcCCGGAATCATAGTACCAGAGGCATTGGGCTT
AGGTAATTGGGTCAAGGCCCAAGAATGGGCAGCCATTCCTGGTGGACAAGCTACATATTTGGGCCAGCCTGTTCCATGGGGAACACTTCC
TACTATTTTGGCTATTGAATTTCTAGCCATAGCTTTTGTAGAACACCAAAGGAGTATGGAAAAAGATTCAGAAAAGAAGAAGTACCCTGG
TGGGGCTTTTGACCCATTGGGCTACTCTAAAGACCCTGCTAAATTTGAAGAACTCAAAGTCAAGGAAATCAAGAAtGGTTAAAATATTAA
CTCaCTCCTTCCTCTTATTATATTTATGGATTTAAGGTATATATGCTGAACATTATCATCTCGAATAAXTTGGTGATTAGGGCGTCCTTG
cGTTGTTGGAATTGGTGGGAATTTTGTGTACAACAATCACCATTATCCXGGAACAGGAACCATTGGAAAAATTTGGCAACTTCCCTTGGG
TGGACCCTGG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan