ESTScan Details for Unigene SGN-U333949

Score 
233
Direction 
Forward
Predicted Peptide Sequence 
MARKEIDDYKSXELLKEFESDLMCKGKLSWPELIGVPAQYAKGIIQKENPFVTDVQIVLNGSPVTADFTCYRDRIDVNILNVAVSIPVVG
Predicted Coding Sequence 
ATGGCACGAAAAGAAATTGATGACTATAAGTCAXCAGAACTTCTAAAGGAATTTGAATCCGACTTGATGTGCAAAGGAAAATTAAGTTGG
CCAGAACTTATTGGTGTACCAGCACAATATGCTAAGGGAATAATTCAGAAGGAAAATCCATTCGTAACTGATGTTCAAATAGTATTGAAT
GGTTCTCCAGTCACAGCTGATTTTACGTGTTATCGAGATCGTATTGATGTAAACATTTTAAATGTTGCTGTATCAATTCCAGTGGTTGGT
TAA
Edits in Original Sequence 
CATAAGAAATAGTTTGATCTTGTAAATATAATGTGACTAACTGACAAAGTAGGTTCGAAAGAGTGACTTGTTGAAATTGCATTATTTAAT
GAAAATGTTGACTCTCTTAATGAAATGTATATATTGACTTTTAATTTTTAGTGAAAATGTTGGCTTTGCTTGTGCCAGAGATTTTTAGGC
ATCATAATTTTCTGATAATCTAACTTGAAATAAGAAATATACTAATTGCTATTGAAATATTTTTTTTTACAGCCTTTGAAACTCTCATGG
CACGAAAAGAAATTGATAGACTATAAGTCACAGAACTTCTAAAGGAATTTGAATCCGACTTGATGTGCAAAGGAAAATTAAGTTGGCCAG
AACTTATTGGTGTACCAGCACAATATGCTAAGGGAATAATTCAGAAGGAAAATCCA
(5')ATGGCACGAAAAGAAATTGATaGACTATAA
GTCAXCAGAACTTCTAAAGGAATTTGAATCCGACTTGATGTGCAAAGGAAAATTAAGTTGGCCAGAACTTATTGGTGTACCAGCACAATA
TGCTAAGGGAATAATTCAGAAGGAAAATCCATTCGTAACTGATGTTCAAATAGTATTGAATGGTTCTCCAGTCACAGCTGATTTTACGTG
TTATCGAGATCGTATTGATGTAAACATTTTAAATGTTGCTGTATCAATTCCAGTGGTTGGTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan