ESTScan Details for Unigene SGN-U333950

Score 
415
Direction 
Forward
Predicted Peptide Sequence 
MESKFAHIIVFFLLATSFETLNAQRNGLEFIKLVKELKSVHEPKPNLECQGKLMWPELIGVPAQYAKGIIEKENPLTHVQIVLNGSPITT
DLSCNRVRIAVNILDYAVSMPVVG
Predicted Coding Sequence 
ATGGAGTCAAAGTTTGCTCACATTATTGTTTTCTTTCTTCTTGCAACTTCTTTTGAAACTCTCAATGCGCAAAGAAATGGACTAGAATTC
ATAAAACTTGTAAAGGAATTGAAATCGGTTCATGAGCCCAAGCCCAACTTGGAATGTCAAGGAAAACTAATGTGGCCAGAACTTATTGGT
GTACCAGCACAATATGCTAAGGGAATAATTGAGAAGGAAAATCCACTTACTCATGTTCAAATAGTATTGAATGGTTCTCCAATCACAACT
GATTTAAGTTGTAATCGAGTTCGAATTGCTGTAAACATCTTGGATTATGCTGTATCAATGCCTGTGGTTGGTTAA
Edits in Original Sequence 
CTCTTTACATTACAACTAAAACCAAAATGGAGTCAAAGTTTGCTCACATTATTGTTTTCTTTCTTCTTGCAACTTCTTTTGAAACTCTCA
ATGCGC
(5')ATGGAGTCAAAGTTTGCTCACATTATTGTTTTCTTTCTTCTTGCAACTTCTTTTGAAACTCTCAATGCGCAAAGAAATGG
ACTAGAATTCATAAAACTTGTAAAGGAATTGAAATCGGTTCATGAGCCCAAGCCCAACTTGGAATGTCAAGGAAAACTAATGTGGCCAGA
ACTTATTGGTGTACCAGCACAATATGCTAAGGGAATAATTGAGAAGGAAAATCCACTTACTCATGTTCAAATAGTATTGAATGGTTCTCC
AATCACAACTGATTTAAGTTGTAATCGAGTTCGAATTGCTGTAAACATCTTGGATTATGCTGTATCAATGCCTGTGGTTGGTTAA(3')T
ATCCATGTACTCCTACTATATATAATGGAATAAATAAGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan