ESTScan Details for Unigene SGN-U333951

Score 
-354
Direction 
Reverse
Predicted Peptide Sequence 
KSPHKAPGSLFDLYSTFLFDTKFPRGFSPGKSLKFAGGPSKGFRLLGVLRAPWALKKTCIRGGRFHVVGPLRPDKAGFFPPLTLGVPRFL
ISGLLFQNGNNHSTPIWSIFLINKGDFADLGLLVXKMSGFNKNLTRILQNINAYNLPFAIQAAQLLGRAIGAGLFAITPAGERGMCCKAI
KLGNARVFPVTTVVKRRPVNCNTTHYRANWVPGPXLEFFFLLATSFETLMARKEIDRPEVTELLKEFESDLMCKGKLSWPELIGVPAQYA
KGIIEKENPFITDVQIVLNGSPVTADFRCFRVRIVVNILNIAVSIPVVG
Predicted Coding Sequence 
XTCAAGAGCCCCCATAAGGCGCCGGGTTCCCTCTTCGATTTGTATTCCACTTTCCTTTTTGACACAAAGTTTCCGCGCGGTTTTTCCCCX
GGTAAAAGTTTAAAATTTGCGGGGGGCCCCTCTAAGGGTTTCCGATTATTAGGGGTTTTAAGGGCCCCCTGGGCCCTCAAAAAAACTTGT
ATTAGGGGGGGAAGGTTTCACGTAGTGGGGCCCCTTCGCCCCGATAAAGCXGGTTTTTTCCCCCCTTTGACGTTGGGAGTCCCCCGTTTT
TTAATTAGTGGACTTTTGTTCCAAAATGGGAACAACCACTCAACCCCTATTTGGTCTATTTTTTTGATTAATAAAGGXGATTTTGCCGAT
TTGGGCCTTTTGGTTAAXAAAATGAGCGGATTTAACAAAAATTTAACGCGAATTTTACAAAATATTAACGCTTACAATTTGCCATTCGCC
ATTCAGGCTGCGCAACTGTTGGGAAGGGCGATCGGTGCGGGCCTCTTCGCTATTACGCCAGCTGGCGAAAGGGGGATGTGCTGCAAGGCG
ATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACXGTTGTAAAACGACGGCCAGTGAATTGTAATACGACTCACTATAGGGCGAAT
TGGGTACCGGGCCCCXCCCTCGAGTTTTTTTTTCTTCTCGCAACTTCCTTTGAAACTCTCATGGCACGAAAAGAAATTGATAGACCAGAA
GTCACAGAACTTTTAAAGGAATTTGAATCCGACTTGATGTGCAAAGGAAAACTAAGTTGGCCAGAACTTATTGGTGTACCAGCACAATAT
GCTAAGGGAATAATTGAGAAGGAAAATCCATTCATAACTGATGTTCAAATAGTATTGAATGGTTCTCCAGTCACAGCTGATTTTAGGTGT
TTTCGAGTTCGTATTGTTGTAAACATCTTGAATATTGCTGTATCAATTCCTGTGGTTGGTTAA
Edits in Original Sequence 
(5')XTCAAGAGCCCCCATAAGGCGCCGGGTTCCCTCTTCGATTTGTATTCCACTTTCCTTTTTGACACAAAGTTTCCGCGCGGTTTTTC
CCCXGGTAAAAGTTTAAAATTTGCGGGGGGtCCCCTCTAAGGGTTTCCGATTATTAGGGGTTTTAAGGGCCCCCTGGGCCCTCAAAAAAA
CTTGTATTAGGGGGGGAAGGTTTCACGTAGTGGGGCCCCTTCGCCCCGATAAAGCXGGTTTTTTCCCCCCTTTGACGTTGGGAGTCCCCC
GTTTTTTAATTAGTGGACTTTTGTTCCAAAATGGGAACAACCACTCAACCCCTATTTcGGTCTATTTTTTTGATTAATAAAGGXGATTTT
GCCGATTTGGGCCTTTTGGTTAAXAAAATGAGCGGATTTAACAAAAATTTAACGCGAATTTTaACAAAATATTAACGCTTACAATTTGCC
ATTCGCCATTCAGGCTGCGCAACTGTTGGGAAGGGCGATCGGTGCGGGCCTCTTCGCTATTACGCCAGCTGGCGAAAGGGGGATGTGCTG
CAAGGCGATTAAGTTGGGTAACGCCAGGGTTTTCCCAGTCACGACXGTTGTAAAACGACGGCCAGTGAATTGTAATACGACTCACTATAG
GGCGAATTGGGTACCGGGCCCCXCCCTCGAGTTTTTTTTTCTTCTCGCAACTTCCTTTGAAACTCTCATGGCACGAAAAGAAATTGATAG
ACCAGAAGTCACAGAACTTTTAAAGGAATTTGAATCCGACTTGATGTGCAAAGGAAAACTAAGTTGGCCAGAACTTATTGGTGTACCAGC
ACAATATGCTAAGGGAATAATTGAGAAGGAAAATCCATTCATAACTGATGTTCAAATAGTATTGAATGGTTCTCCAGTCACAGCTGATTT
TAGGTGTTTTCGAGTTCGTATTGTTGTAAACATCTTGAATATTGCTGTATCAATTCCTGTGGTTGGTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan