ESTScan Details for Unigene SGN-U333977

Score 
158
Direction 
Reverse
Predicted Peptide Sequence 
RAAALRIRRVLQGLPTDNCDKEILEKREGYFGENGCDKDNEKKFGEGYRNSFGPGGRILGRDFKSFIEKKKSLLQTKVFPNVKRAEVEGV
ENCSPPEAEESKYLYVRRSLVEDTNKKDIEDAHSANGVSLGYEKEIRSVVQEKAEKEVLRFFPRNPGSGGDGKEVVFPGGVRDMGK
Predicted Coding Sequence 
AGGGCGGCCGCTTTGAGAATTAGGAGGGTTTTGCAGGGACTACCAACCGATAATTGTGATAAGGAAATTTTGGAAAAGAGGGAAGGTTAT
TTTGGAGAGAATGGTTGCGATAAGGACAATGAGAAGAAATTCGGXGAGGGCTACAGAAACAGTTTTGGTCCGGGAGGACGGATACTGGGT
AGAGACTTTAAGTCCTTCATTGAGAAAAAGAAAAGCTTGCTACAAACTAAAGTATTTCCTAATGTXAAGAGGGCAGAGGTAGAGGGAGTA
GAAAATTGTAGCCCCCCCGAAGCGGAAGAATCAAAGTATTTGTATGTTAGGAGATCTCTAGTTGAAGACACAAACAAAAAGGACATTGAG
GATGCACACTCAGCAAACGGAGTTTCTTTGGGTTATGAAAAAGAAATAAGGTCTGTTGTTCAAGAAAAAGCGGAAAAGGAAGTTCTGAGA
TTTTTCCCCAGGAATCCAGGCAGCGGTGGGGACGGGAAAGAGGTGGTTTTTCCGGGGGGAGTAAGAGACATGGGAAAATAA
Edits in Original Sequence 
GGAAAGAGGTGGTTTTTCCGGGGGGAGTAAGAGACATGGGAAAATAAGATGGTACATGGAGGGGTTAGAAATC(5')AGGGCGGCCGCTT
TGAGAATTAGGAGGGTTTTGCAGGGACTACCAACCGATAATTGTGATAAGGAAATTTTGGAAAAGAGGGAAGGTTATTTTGGAGAGAATG
GTTGCGATAAGGACAATGAGAAGAAATTCGGXGAGGGCTACAGAAACAGTTTTGGTCCGGGAGGACGGATACTGGGTAGAGACTTTAAGT
CCTTCATTGAGAAAAAGAAAAGCTTGCTACAAACTAAAGTATTTCCtTAATGTXAAGAGGGCAGAGGTAGAGGGAGTAGAAAATTGTAGC
CCCCCCGcAAGCGGAAGAATCAAAGTATTTGTATGTTAGGAGATCTCTAGTTGAAGACACAAACAAAAAGGACATTGAGGATGCACACTC
AGCAAACGGAGTTTCTTTGGGTTATGAAAAAGAAATAAGGTCTGTTGTTCAAGAAAAAGCGGAAAAGGAAGTTCTGAGaATTTTTCCCCA
GGAATCCAGGCAGCGGTGGGGACGGGAAAGAGGTGGTTTTTCCGGGGGGAGTAAGAGACATGGGAAAATAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan