ESTScan Details for Unigene SGN-U334096

Score 
316
Direction 
Forward
Predicted Peptide Sequence 
TGGGAPPXLAGRSRTSGSPGLQESARGTVQSRVNLSSRKMAPIAVGDVIPDGTVSYFDEQDQMQTVSVYSLAKGKKVIIFAVPGADLSDK
GLGVRSRRYALLVDDLEVKVANIESGGEFTVSGADEIVNAL
Predicted Coding Sequence 
XXGACTGGAGGTGGAGCTCCACCGXCGTTGGCNGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATCGGCACGAGGCACTGTG
CAATCTCGTGTCAACCTAAGTAGCAGAAAAATGGCTCCAATCGCCGTTGGTGACGTCATCCCCGATGGTACCGTATCTTACTTCGACGAG
CAAGATCAGATGCAGACCGTCTCAGTATACTCACTTGCTAAGGGCAAGAAGGTCATCATCTTCGCCGTTCCTGGAGCTGATCTGTCGGAT
AAGGGGCTTGGTGTTCGATCACGAAGGTATGCTCTTTTGGTTGATGACCTTGAGGTGAAAGTAGCTAACATTGAATCTGGAGGGGAGTTC
ACGGTCTCCGGTGCTGATGAAATCGTCAATGCTCTTTAA
Edits in Original Sequence 
(5')XXGACTGGAGGTGGAGCTCCACCGXCGTTGGCNGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATCGGCACGAGGCAC
TGTGCAATCTCGTGTCAACCTAAGTAGCAGAAAAATGGCTCCAATCGCCGTTGGTGACGTCATCCCCGATGGTACCGTATCTTACTTCGA
CGAGCAAGATCAGATGCAGACCGTCTCAGTATACTCACTTGCTAAGGGCAAGAAGGTCATCATCTTCGCCGTTCCTGGAGCtTGATCTGT
CGGATAAGGGGCTTGGTGTTCGATCACGAAGGTATGCTCTTTTGGTTGATGACCTTGAGGTGAAAGTAGCTAACATTGAATCTGGAGGGG
AGTTCACGGTCTCCGGTGCTGATGAAATCGTCAATGCTCTTTAA(3')CTGTAGTCGCTAATATCAAACTTTGTATGAAGAATGCTTTGT
GGAAATAAGAATTTCTTGCTTTACTAATGTGTTGGAGGCAAAGAAACTGGCAATATGTAAAATTACTCTGGGGTGAGGTGTGGACAGTAG
CGTTGTAACT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan