ESTScan Details for Unigene SGN-U334115

Score 
450
Direction 
Reverse
Predicted Peptide Sequence 
LKIPNLRFPXITFFAILCLEPSKVRLXLRAIDNXESFQNPSSDRSISEVQALHIQAIGSMSSEDMTAFKALHLPKTLXSCLARSGLIPYX
KVVTVVNAFLGKGEENEKAKEEVYEMLKILDNELKNKKFFVGDKFGIADIVANLVGLWLGVFQEGSGVELVTSEKFPNFCSWRDEYVNCS
QVKEYLPRKDDLLAFFQAFTRAQAAASASTQK
Predicted Coding Sequence 
XXCTTAAAAATCCCAAACCTTCGTTTCCCCXCCATAACATTTTTTGCCATATTGTGTTTGGAACCATCCAAAGTAAGGCTTAXACTAAGA
GCAATTGATAATAAXGAGTCATTTCAAAACCCTTCTTCTGATCGATCTATTTCAGAAGTCCAGGCTCTTCACATACAAGCCATTGGATCA
ATGTCATCTGAAGACATGACAGCATTTAAGGCCCTCCATCTGCCTAAAACCCTATGATCGTGCTTAGCTCGTTCTGGGCTAATTCCTTAT
GNCAAGGTGGTTACGGTGGTAAATGCATTCTTAGGCAAAGGAGAGGAGAATGAGAAAGCTAAAGAGGAAGTTTATGAGATGTTGAAAATT
CTTGATAATGAACTCAAAAACAAGAAGTTTTTTGTGGGTGACAAATTTGGAATTGCTGATATTGTTGCAAATTTGGTTGGACTTTGGCTT
GGAGTTTTCCAAGAAGGCTCTGGAGTCGAATTAGTAACAAGCGAAAAATTTCCAAATTTCTGTAGTTGGAGAGATGAGTACGTTAATTGC
AGTCAAGTCAAGGAGTATCTGCCTCGAAAAGATGATTTGCTTGCTTTTTTCCAAGCTTTCACTCGTGCTCAAGCTGCAGCTTCTGCTTCT
ACTCAAAAATAA
Edits in Original Sequence 
(5')XXCTTAAAAATCCCAAACCTTCGTTTCCCCXCCATAACATTTTTTGCCATATTGTGTTTGGAACCATCCAAAGTAAGGCTTAXACT
AAGAGCAATTGATAATAAXGAGTCATTTCAAAACCCTTCTTCTGATCGATCTATTTCAGAAGTCCAGGCTCTTCACATACAAGCCATTGG
ATCAATGTCATCTGAAGACATGACgAGCATTTAAGGCCCTCCATCTGCCTAAAACCCTATGATCGTGCTTAGCTCGTTCTGGGCTAAgTT
CCTTATGNCAAGGTGGTTACGGTGGTAAATGCATTCTTAGGCAAAGGAGAGGAGAATGAGAAAGCTAAAGAGGAAGTTTATGAGATGTTG
AAAATTCTTGATAATGAACTCAAAAACAAGAAGTTTTTTGTGGGTGACAAATTTGGAATTGCTGATATTGTTGCAAATTTGGTTGGACTT
TGGCTTGGAGTTTTCCAAGAAGGCTCTGGAGTCGAATTAGTAACAAGCGAAAAATTTCCAAATTTCTGTAGTTGGAGAGATGAGTACGTT
AATTGCAGTCAAGTCAAGGAGTATCTGCCTCGAAAAGATGATTTGCTTGCTTTTTTCCAAGCTTTCACTCGTGCTCAAGCTGCAGCTTCT
GCTTCTACTCAAAAATAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan