ESTScan Details for Unigene SGN-U334204

Score 
660
Direction 
Reverse
Predicted Peptide Sequence 
GIHFNFTDRKCMESXDKGWQVLEFASVHGNLYXTSVEAVEVGADAGKRCILDIDVQGARSVRASALEAIFIFIAPPSFDELEKRLRARAT
ETEEQIQKRLQNARAELEQGKSSGLFDHILVNDDLETCYEKLKNILCLREAVKSAPKTKSFNLSIKHPVSMIDQKLLINCTAAEDENTST
NMYVLDFLLKGGAPGRTRGLNMYAINPLTDDVNGNXPAALNIQF
Predicted Coding Sequence 
XATGGAATTCATTTCAATTTTACTGACCGCAAATGTATGGAGAGTAAXGATAAAGGATGGCAAGTTCTTGAATTTGCTTCTGTTCATGGT
AATCTCTATGNAACAAGTGTAGAAGCTGTTGAGGTGGGTGCTGATGCTGGCAAGCGATGTATCCTTGATATCGATGTTCAAGGAGCAAGG
TCTGTGAGAGCTAGCGCTCTTGAAGCCATTTTCATTTTCATTGCTCCTCCTTCTTTTGACGAACTTGAGAAGCGTCTTCGTGCAAGGGCA
ACTGAGACCGAGGAACAAATCCAAAAGCGTCTCCAGAATGCTAGGGCAGAACTTGAACAAGGAAAATCATCTGGTCTGTTTGATCATATT
TTGGTAAACGATGATCTTGAAACTTGTTATGAGAAACTCAAGAACATTTTGTGTCTAAGAGAAGCTGTGAAATCTGCTCCTAAGACAAAA
TCATTCAACTTGTCCATCAAACATCCAGTGTCAATGATCGATCAAAAGCTTCTGATCAACTGTACTGCTGCAGAAGATGAAAATACATCA
ACTAACATGTACGTTCTGGACTTTTTGCTCAAAGGAGGAGCCCCTGGACGGACAAGAGGACTAAACATGTATGCTATCAATCCTTTGACT
GATGATGTAAATGGTAACAAXCCAGCTGCACTTAACATCCAGTTTTGA
Edits in Original Sequence 
(5')XATGGAATTCATTTCAATTTTACTGACCGCAAATGTATGGAGAGTAAXGATAAAGGATGGCAAGTTCTTGAATTTGCTTCTGTTCA
TGGTAATCTCTATGNAACAAGTGTAGAAGCTGTTGAGGTGGGTGCTGATGCTGGCAAGCGATGTATCCTTGATATCGATGTTCAAGGAGC
AAGGTCTGTGAGAGCTAGCGCTCTTGAAGCCATTTTCATTTTCATTGCTCCTCCTTCTTTTGACGAACTTGAGAAGCGTCTTCGTGCAAG
GGCAACTGAGACCGAGGAACAAATCCAAAAGCGTCTCCAGAATGCTAGGGCAGAACTTGAACAAGGAAAATCATCTGGTCTGTTTGATCA
TATTTTGGTAAACGATGATCTTGAAACTTGTTATGAGAAACTCAAGAACATTTTGTGTCTAAGAGAAGCTGTGAAATCTGCTCCTAAGAC
AAAATCATTCAACTTGTCCATCAAACATCCAGTGTCAATGATCGATCAAAAGCTTCTGATCAACTGTACTGCTGCAGAAGATGAAAATAC
ATCAACTAACATGTACGTTCTGGACTTTTTGCTCAAAGGAGGAGCCCCTGGACGGACAAGAGGACTAAACATGTATGCTATCAATCCTTT
GACTGATGATGTAAATGGTAACAAXCCAGCTGCACTTAACATCCAGTTTTGA(3')ACATATGTTGGATAGGATGCTTTTCGTTCTTTTA
TCTATTTGGTTTCGTTTCTTCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan