ESTScan Details for Unigene SGN-U334238

Score 
-420
Direction 
Forward
Predicted Peptide Sequence 
MGHPKSLIHSLIFRHHHXLKHKARPQQSSPRAEFLQPGGSTSSRAAATAVELQLLFPLVRVNFELGVIMVIAVSCVKLLSLTIPHNIRAG
SINVKPGVPNDELTHINCVALTARFPVGKPVVPAAINESANAAGRGGLRIGRSSASSLTXLAALGRSAAAAVSAHSKAVIRLSTESGDNX
RKEHVSKRPAKGQEPKKAALLAFFHRLRPPDEHHKNXTLKSEVAKPDRTIKIPGVSPWKLPRASPVPTLPLYGYLSAFLPSENVALSHSS
AVGNSIPGKSFPPKLAGWPKPPRLAPTAGPLIRETIPP
Predicted Coding Sequence 
ATGGGGCATCCAAAATCCCTTATTCATTCCCTTATATTCAGACATCATCATGXACTAAAACACAAAGCTAGGCCTCAGCAAAGTTCCCCT
CGTGCCGAATTCCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCGGCCGCCACCGCGGTGGAGCTCCAGCTTTTGTTCCCTTTAGTGAGG
GTTAATTTCGAGCTTGGCGTAATCATGGTCATAGCTGTTTCCTGTGTGAAATTGTTATCCCTCACAATTCCACACAACATACGAGCCGGA
AGCATAAATGTAAAGCCTGGGGTGCCTAATGATGAGCTAACTCACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCT
GTCGTGCCAGCTGCXATTAATGAATCGGCCAACGCXGCGGGGAGAGGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGAX
CTCGCTGCGCTCGGTCGTTCGGCTGCGGCGGCGGTATCAGCTCACTCAAAGGCGGTAATACGGTTATCCACAGAATCAGGGGATAACXGC
AGGAAAGAACATGTGAGCAAAAGGCCAGCAAAAGGCCAGGAACCTAAAAAGGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCT
GACGAGCATCACAAAAATCXGACGCTCAAGTCAGAGGTGGCGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCTC
CCTCGTGCCTCTCCTGTTCCGACCCTGCCGCTTTACGGATACCTGTCCGCCTTTCTCCCTTCGGAAAACGTGGCGCTTTCTCATAGCTCA
GCTGTAGGTAACTCAATTCCGGGTAAGTCCTTTCCTCCAAAGCTGGCTGGGTGGCCCAAACCCCCCCGTTTAGCCCCAACCGCTGGCCCC
TTAATCCGGGAAACTATTCCTCCTTGA
Edits in Original Sequence 
TTTTTTTTTTTTTTTCGATGAGAAATAGTACATGTGGTATAATACCATAAAGATAAAGAAACTCTTATTTGTGTTTGACAAAATACATTA
CTACATATTCCAAATGGGGCATCCAAAATCCCTTATTCATT
(5')ATGGGGCATCCAAAATCCCTTATTCATTCCCTTATATTCAGACAT
CATCATGXACTAAAACACAAAGCTAGGCCTCAGCAAAGTTCCCCTCGTGCCGAATTCCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCG
GCCGCCACCGCGGTGGAGCTCCAGCTTTTGTTCCCTTTAGTGAGGGTTAATTTCGAGCTTGGCGTAATCATGGTCATAGCTGTTTCCTGT
GTGAAATTGTTATCCgCTCACAATTCCACACAACATACGAGCCGGAAGCATAAAgTGTAAAGCCTGGGGTGCCTAATGAgTGAGCTAACT
CACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCXATTAATGAATCGGCCAACGCXGCGGGG
AGAGGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGAXCTCGCTGCGCTCGGTCGTTCGGCTGCGGCGaGCGGTATCAGC
TCACTCAAAGGCGGTAATACGGTTATCCACAGAATCAGGGGATAACXGCAGGAAAGAACATGTGAGCAAAAGGCCAGCAAAAGGCCAGGA
ACCgTAAAAAGGCCGCGTTGCTGGCGTTTTTCCATAGGCTCCGCCCCCCTGACGAGCATCACAAAAATCXGACGCTCAAGTCAGAGGTGG
CGAAACCCGACAGGACTATAAAGATACCAGGCGTTTCCCCCTGGAAGCTCCCTCGTGCgCTCTCCTGTTCCGACCCTGCCGCTTTACGGA
TACCTGTCCGCCTTTCTCCCTTCGGAAAACGTGGCGCTTTCTCATAGCTCAcGCTGTAGGTAACTCAATTCCGGGTAAGTCCTTTCCTCC
AAAGCTgGGCTGGGTGGCCCAAACCCCCCCGTTTAGCCCCAACCGCTGGCCCCTTAATCCGGGAAACTATTCCTCCTTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan