ESTScan Details for Unigene SGN-U334272

Score 
862
Direction 
Forward
Predicted Peptide Sequence 
RGGLGIFNDGGKKGIHAVAAAXRTSGSPGLQEFGRGEKPSHAHEEEAISSELSEKVNEVKKWNHKEEEKKEEKKLHRSNSSSSSSSDEEE
EIGEDGQKIKKKKKKGLKDKIKEKISGDHKEESKAEDTSVPVEKYEETEEKKGFLDKIKEKLPGGGHKKTEEVAAPPPPPPAAVEHEAEG
KEKKGFLDKIKEKLPGYHSKAEEEKEKEKD
Predicted Coding Sequence 
CGGGGGGGNCTCGGAATTTTTAATGACGGGGGAAAGAAGGGAATCCATGCGGTGGCTGCCGCTXCTAGAACTAGTGGATCCCCCGGGCTG
CAGGAATTCGGCAGAGGGGAAAAACCAAGTCATGCTCATGAAGAAGAGGCAATTTCATCTGAGTTGTCTGAAAAAGTTAACGAAGTGAAG
AAGTGGAACCACAAGGAGGAGGAAAAGAAAGAAGAGAAGAAACTTCATCGATCAAATAGCAGCTCTAGTAGCTCCAGTGATGAGGAGGAA
GAAATTGGAGAGGATGGACAGAAGATCAAGAAGAAGAAAAAGAAGGGATTGAAGGATAAGATTAAGGAAAAAATATCTGGTGATCACAAG
GAAGAATCGAAAGCAGAGGATACTTCAGTTCCAGTTGAGAAATACGAGGAAACAGAGGAGAAAAAAGGATTTCTAGACAAAATTAAGGAG
AAATTGCCAGGTGGCGGACATAAGAAGACGGAGGAAGTAGCGGCGCCGCCACCACCACCACCGGCTGCGGTGGAGCATGAGGCGGAGGGG
AAGGAGAAAAAGGGATTTTTGGACAAAATTAAGGAGAAATTACCAGGGTACCACTCAAAGGCTGAAGAGGAAAAGGAGAAGGAAAAAGAC
TAA
Edits in Original Sequence 
(5')CGGGGGGGNCTCGGAATTTTTAATGACGGGGGAAAGAAGGGAATCCATGCGGTGGCTGCCGCTXCTAGAACTAGTGGATCCCCCGG
GCTGCAGGAATTCGGCAcGAGGGGAAAAACCAAGTCATGCTCATGAAGAAGAGGCAATTTCATCTGAGTTGTCTGAAAAAGTTAACGtAA
GTGAAGAAGTGGAACCACAAGGAGGAGGAAAAGAAAGAAGAGAAGAAACTTCATCGATCAAATAGCAGCTCTAGTAGCTCCAGTGATGAG
GAGGAAGAAATTGGAGAGGATGGACAGAAGATCAAGAAGAAGAAAAAGAAGGGATTGAAGGATAAGATTAAGGAAAAAATATCTGGTGAT
CACAAGGAAGAATCGAAAGCAGAGGATACTTCAGTTCCAGTTGAGAAATACGAGGAAACAGAGGAGAAAAAAGGATTTCTAGACAAAATT
AAGGAGAAATTGCCAGGTGGCGGACATAAGAAGACGGAGGAAGTAGCGGCGCCGCCACCACCACCACCGGCTGCGGTGGAGCATGAGGCG
GAGGGGAAGGAGAAAAAGGGATTTTTGGACAAAATTAAGGAGAAATTACCAGGGTACCACTCAAAGGCTGAAGAGGAAAAGGAGAAGGAA
AAAGACTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan