ESTScan Details for Unigene SGN-U334274

Score 
546
Direction 
Reverse
Predicted Peptide Sequence 
KRLSKLKSWNPRGGKKIFLVQKEALVAPXDEEEKIGEDGQKFKKKKKKGLRDKIKEKIFGVHKEDSKAGDPSVPVEKSEEPEEKKGFLAK
IKEKLPGGGHKKTEEVGAPPPPPPVGVEHKAEGKEKKGFLDKIKEKFPGSPSKGEEEKEKEKA
Predicted Coding Sequence 
XTGAAAAGGTTAAGTAAATTGAAAAGTTGGAACCCAAGGGGGGGGAAAAAAATTTTCTTGGTTCAAAAAGAAGCTTTAGTAGCTCCAGXT
GATGAGGAGGAAAAAATTGGAGAGGATGGCCAGAAGTTCAAGAAGAAGAAAAAGAAGGGATTGAGGGATAAGATTAAGGAAAAAATATTT
GGTGTTCACAAGGAAGATTCGAAAGCAGGGGATCCCTCAGTTCCAGTTGAGAAATCCGAGGAACCAGAGGAGAAAAAAGGTTTTTTAGCC
AAAATTAAGGAGAAATTGCCAGGTGGCGGGCATAAAAAAACGGAGGAAGTGGGGGCGCCCCCCCCACCACCACCGGTTGGGGTGGAGCAT
AAGGCGGAGGGGAAGGAAAAAAAGGGATTTTTGGACAAAATTAAGGAGAAATTTCCGGGATCCCCCTCAAAGGGTGAAGAGGAAAAGGAG
AAGGAAAAAGCCTAA
Edits in Original Sequence 
(5')XTGAAAAGGTTAAGTAAATTGAAAAGTTGGAACCCAAGGGGGGGGAAAAAAATTTTCTTGGTTCAAAAAGAAGCTTTAGTAGCTCC
AGXTGATGAGGAGGAAAAAATTGGAGAGGATGGCCAGAAGTTCAAGAAGAAGAAAAAGAAGGGATTGAGGGATAAGATTAAGGAAAAAAT
ATTTGGTGTTCACAAGGAAGATTCGAAAGCAGGGGATCCCTCAGTTCCAGTTGAGAAATCCGAGGAACCAGAGGAGAAAAAAGGTTTTTT
AGCCAAAATTAAGGAGAAATTGCCAGGTGGCGGGCATAAAAAAACGGAGGAAGTGGGGGCGCCCCCCCCACCACCACCGGTTGGGGTGGA
GCATAAGGCGGAGGGGAAGGAAAAAAAGGGATTTTTGGACAAAATTAAGGAGAAATTTCCGGGATCCCCCTCAAAGGGTGAAGAGGAAAA
GGAGAAGGAAAAAGCCTAA(3')TTTTATCCTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan