ESTScan Details for Unigene SGN-U334328

Score 
-106
Direction 
Forward
Predicted Peptide Sequence 
MREAQTRIENHGFQGAGGGGGVGNIGGTAKNKVFLSIPTSLSPRAEFLQPGGSTSSRAAATAGELQLLFPLVRVNFELGVIMVIAVSWVK
LLSLTIPHNIRAGSINVKPGVPNDELTHINCVALTARFPVGKPVVPAAINESANPRGEAVCLLGALPLPRSLTPCARSFGCGQRNHLTQR
REYGFSPKSGGKPQEKTCEPKGPPKGQEXRKKGPVAWAFFPKA
Predicted Coding Sequence 
ATGAGGGAGGCACAAACACGTATTGAAAATCATGGTTTCCAAGGAGCTGGCGGAGGTGGTGGAGTGGGAAACATCGGTGGTACTGCAAAA
AATAAAGTGTTCTTATCAATTCCGACATCTCTATCTCCTCGTGCCGAATTCCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCGGCCGCC
ACCGCGGGGGAGCTCCAGCTTTTGTTCCCTTTAGTGAGGGTTAATTTCGAGCTTGGCGTAATCATGGTCATAGCTGTTTCCTGGGTGAAA
TTGTTATCCCTCACAATTCCACACAACATACGAGCCGGAAGCATAAATGTAAAGCCTGGGGTGCCTAATGATGAGCTAACTCACATTAAT
TGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCXATTAATGAATCGGCCAACCCCCGGGGAGAGGCGGTT
TGCCTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGACTCCCTGCGCTCGGTCGTTCGGCTGCGGGCAGCGGAATCACCTCACTCAAAGG
CGGGAATACGGTTTTTCCCCCAAATCAGGGGGAAAACCGCAGGAAAAAACATGTGAACCAAAAGGCCCACCAAAGGGCCAAGAACXCCGT
AAAAAAGGCCCCGTTGCCTGGGCTTTTTTCCCTAAGGCT
Edits in Original Sequence 
TTTTTTTTTTTTTTCTTTTTGGGACACACAAAACACGAACCTTTTAAGAAAACTTGTTCCGAGGAAATTGAGGTTACACTGCCTTAAAAA
TACATGATTGGTTACGTTACATTCATACTGGGTGTAGATGATACATCCAAGTAAAACAGACATGCATTGGGCATTTCTTGAAGAATTTCA
CTTGCTAGTCCTAATAATGCCCAAACTACTATCTATGTTCAAGGGTGCACATCCAAATTCCTTGTCTTTCATCTAAACTTCTTTGTCTCA
GAATCTAATATCAAAAATAAAGAACCTACACTCAGATGAGGGAGGCACAAACCACGTATTGAAAATCATGG
(5')ATGAGGGAGGCACAA
AcCACGTATTGAAAATCATGGTTTCCAAGGAGCTGGCGGAGGTGGTGGAGTGGGAAACATCGGTGGTACTGCAAAAAATAAAGTGTTCTT
ATCAATTCCGACATCTCTATCTCCTCGTGCCGAATTCCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCGGCCGCCACCGCGGGGGAGCT
CCAGCTTTTGTTCCCTTTAGTGAGGGTTAATTTCGAGCTTGGCGTAATCATGGTCATAGCTGTTTCCTGGGTGAAATTGTTATCCgCTCA
CAATTCCACACAACATACGAGCCGGAAGCATAAAgTGTAAAGCCTGGGGTGCCTAATGAgTGAGCTAACTCACATTAATTGCGTTGCGCT
CACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCXATTAATGAATCGGCCAACCCCCGGGGAGAGGCGGTTTGCCTATTGGG
CGCTCTTCCGCTTCCTCGCTCACTGACTCCCTGCGCTCGGTCGTTCGGCTGCGGGCAGCGGAATCACCTCACTCAAAGGCGGGAATACGG
TTTTTCCCCCAAATCAGGGGGAAAACCGCAGGAAAAAACATGTGAACCAAAAGGCCCACCAAAGGGCCAAGAACXCCGTAAAAAAGGCCC
CGTTGCCTGGGCTTTTTTCCCTAAGGCT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan