ESTScan Details for Unigene SGN-U334331

Score 
884
Direction 
Forward
Predicted Peptide Sequence 
MYGRDPWGGALEINATDSATDDDRSRNLQDFDKAALSRNLDETQQSWLLGPTEQKKKKYVDLGCIIVSRKVFKWTLGCIIAAALIAGFVT
LIVKTVPKHRHHNPPPDNYTLALRKAIMFFNAQRSGKLPKHNNVSWRGSSALQDVIKWGTDYLLKTFNSSADTIDRLVSQVGIGDTSGGP
DPNDHYCWVRPEDIDYPRPVTECHSCSDLAAEMAAALASASIVFKDKKVYSQKLVHGARTPVQFARGKRGKYSTGKEASIFYNSTNYCDE
LXVGGIRPFYATGNTSNLHLGTTPESPTPPGALGESPDXWPASPGKIPPLNPRALNTV
Predicted Coding Sequence 
ATGTATGGGAGGGATCCATGGGGAGGTGCATTAGAAATTAATGCAACAGATTCAGCAACTGATGATGATCGGAGCAGGAACTTGCAGGAT
TTTGATAAAGCAGCTTTGTCACGAAATTTAGATGAAACGCAGCAAAGTTGGTTATTAGGTCCTACAGAGCAAAAGAAGAAGAAATATGTA
GATCTGGGTTGTATTATTGTTAGTAGAAAAGTATTCAAATGGACTCTCGGATGCATTATTGCAGCTGCACTTATTGCTGGATTTGTTACT
CTTATTGTTAAAACTGTACCTAAGCACCGACACCATAATCCTCCACCAGATAACTACACTTTAGCTCTTCGTAAAGCTATCATGTTCTTC
AATGCACAGCGCTCTGGGAAACTTCCTAAGCATAATAATGTATCATGGAGGGGGAGTTCAGCTCTACAGGATGTTATCAAGTGGGGAACT
GATTATCTCTTGAAAACATTCAATTCCTCAGCTGATACCATTGATCGACTCGTTTCACAAGTGGGGATAGGGGATACCTCAGGAGGACCA
GATCCCAATGATCACTATTGTTGGGTGCGTCCAGAAGACATTGATTATCCACGGCCTGTAACTGAATGTCACAGTTGCTCGGATCTTGCT
GCCGAGATGGCTGCTGCACTGGCTTCTGCTTCCATTGTATTTAAGGACAAAAAAGTGTACTCACAAAAGCTTGTCCATGGTGCTAGAACT
CCTGTCCAGTTTGCCAGGGGAAAACGTGGTAAATACAGTACCGGAAAGGAAGCTTCCATTTTCTACAATTCGACTAATTATTGCGATGAG
CTTGXGGTGGGGGGCATCCGGCCTTTTTATGCTACAGGAAATACTTCCAATCTTCACCTTGGCACGACTCCTGAATCCCCAACACCCCCT
GGGGCTTTGGGGGAGAGCCCTGATXTATGGCCGGCTTCCCCGGGAAAAATACCCCCTTTGAACCCACGGGCTCTCAACACCGTTTGA
Edits in Original Sequence 
CCGCTTCACTACTGTACTAGGAGCTCAAACAATCATCAACTCAGTATGTATGGGAGGGATCCATGGGGAGGTGCATTAGAAATTAATGCA
ACAGATTCAGCAACTG
(5')ATGTATGGGAGGGATCCATGGGGAGGTGCATTAGAAATTAATGCAACAGATTCAGCAACTGATGATGATC
GGAGCAGGAACTTGCAGGATTTTGATAAAGCAGCTTTGTCACGAAATTTAGATGAAACGCAGCAAAGTTGGTTATTAGGTCCTACAGAGC
AAAAGAAGAAGAAATATGTAGATCTGGGTTGTATTATTGTTAGTAGAAAAGTATTCAAATGGACTCTCGGATGCATTATTGCAGCTGCAC
TTATTGCTGGATTTGTTACTCTTATTGTTAAAACTGTACCTAAGCACCGACACCATAATCCTCCACCAGATAACTACACTTTAGCTCTTC
GTAAAGCTATCATGTTCTTCAATGCACAGCGCTCTGGGAAACTTCCTAAGCATAATAATGTATCATGGAGGGGGAGTTCAGCTCTACAGG
ATGTTATCAAGTGGGGAACTGATTATCTCTTGAAAACATTCAATTCCTCAGCTGATACCATTGATCGACTCGTTTCACAAGTGGGGATAG
GGGATACCTCAGGAGGACCAGATCCCAATGATCACTATTGTTGGGTGCGTCCAGAAGACATTGATTATCCACGGCCTGTAACTGAATGTC
ACAGTTGCTCGGATCTTGCTGCCGAGATGGCTGCTGCACTGGCTTCTGCTTCCATTGTATTTAAGGACAAAAAAGTGTACTCACAAAAGC
TTGTCCATGGTGCTAGAACTCCTGTCCAGTTTGCCAGGGGAAAACGTGGTAAATACAGTACCGGAAAGGAAGCTTCCATTTTCTACAATT
CGACTAATTATTGCGATGAGCTTGXGGTGGGGGGCATCCGGCCTTTTTATGCTACAGGAAATACTTCCAATCTTCACCTTGGCACGACTC
CTGtAATCCCCAACACCCCCTGGGGCTTTcGGGGGAGAGCCCTGATXTATGGCCGGCTTCCCCGGGAAAAATACCCCCTTTGAACCCACG
GGCTCTCAACACCGTTTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan