ESTScan Details for Unigene SGN-U334435

Score 
185
Direction 
Forward
Predicted Peptide Sequence 
RDETSWSSTAVAAALELVDPRAAGDLLINGQKQTTFSGDQGKTYMFRISNVGLKNSINFRIQGHKMRVVEIEGSHVLQNFYESLDGHVGQ
SMTGLVTLNQASKDYYFGASTRVSRISFTATSSLHYTNSQTPRSGPGPPAPTGQMPWSMLPAKTFRGNLTSNAAGPILKVHFIMGKLPYQ
GLXGMANSAPFINVKLRIAGNRVAYVNPETPLKLGXITSTIPGVVNLDFIQVYPFGGSAYKAQVVFPPLTQMLIEMVFQNIKAPT
Predicted Coding Sequence 
CGGGATGAAACCAGCTGGAGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCGGGCTGCAGGCGACCTCCTAATAAATGGA
CAGAAGCAGACTACCTTCAGTGGTGATCAAGGAAAGACATATATGTTCAGGATTTCAAATGTTGGCTTGAAAAATTCCATTAACTTCAGA
ATTCAGGGCCATAAGATGAGGGTTGTCGAGATTGAAGGATCCCACGTCTTGCAGAACTTCTATGAATCTCTTGATGGCCATGTTGGTCAA
TCTATGACTGGGCTTGTCACATTAAATCAGGCTTCAAAGGACTACTATTTTGGTGCTTCTACAAGGGTCTCCAGGATAAGTTTTACTGCC
ACTTCAAGTCTTCACTACACTAACTCTCAGACACCCCGTTCTGGACCCGGGCCACCTGCTCCAACTGGACAAATGCCTTGGTCGATGTTG
CCAGCCAAGACATTTAGGGGGAATCTGACATCAAATGCAGCTGGCCCAATCCTTAAGGTTCATTTCATTATGGGAAAATTACCATATCAA
GGACTTXTTGGTATGGCTAATTCAGCACCTTTTATCAATGTAAAGCTGAGAATAGCTGGCAATAGGGTGGCTTATGTTAATCCCGAAACT
CCACTTAAGCTTGGTXTGATCACCTCAACAATCCCCGGAGTGGTCAACTTGGACTTCATTCAAGTTTATCCCTTTGGGGGTTCGGCCTAC
AAAGCACAGGTTGTTTTTCCACCTCTTACCCAGATGTTAATCGAAATGGTTTTCCAAAACATTAAGGCCCCCACG
Edits in Original Sequence 
(5')CGGGATGAAACCAGCTGGAGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATcCCCCGGGCTGCAGGCGACCTCCTAATAA
ATGGACAGAAGCAGACTACCTTCAGTGGTGATCAAGGAAAGACATATATGTTCAGGATTTCAAATGTTGGCTTGAAAAATTCCATTAACT
TCAGAATTCAGGGCCATAAGATGAGGGTTGTCGAGATTGAAGGATCCCACGTCTTGCAGAACTTCTATGAATCTCTTGATGGCCATGTTG
GTCAATCTATGACTGGGCTTGTCACATTAAATCAGGCTTCAAAGGACTACTATTTTGGTGCTTCTACAAGGGTCTCCAGGATAAGTTTTA
CTGCCACTTCAAGTCTTCACTACACTAACTCTCAGACACCCCGTTCTGGACCCGGGCCACCTGCTCCAACTGGACAAATGCCTTGGTCGA
TGTTGCCAGCCAAGACATTTAGGGGGAATCTGACATCAAATGCAGCTaGGCCCAATCCTTAAGGTTCATTTCATTATGGGAAAATTACCA
TATCAAGGACTTXTTGGTATGGCTAATTCAGCACCTTTTATCAATGTAAAGCTGAGAATAGCTGGCAATAGGGTGGCTTATGTTAATCCC
GAAACTCCACTTAAGCTTGGTXTGATCACCTCAACAATCCCCGGAGTGGTCAACTTGGACTTCATTCAAGTTTATCCCTTTGGGGGTTCG
GCCTACAtAAGCACAGGTTGTTTTTCCACCTCTTACCCAGATGTTAATCGAAATGGTTTTCCAAAACATTAAGGCCCCCACG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan