Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U334476

Score 
-363
Direction 
Reverse
Predicted Peptide Sequence 
PQLGGKGLPPNWKSLPREVRRKPPRFPKGEKADRFPLSGRVGTRERPRELPGGNAWYLYSPVGFXPPSDLSVDFCDARQGGGAYGKTPAT
AAFLRFLAFCWPFAHMFFPALSPDSVDNRITPLSELIPLAAAERPSAAESVSEEAEERPIRKPPLPAVGRFINAAGTTGFPTGKRAVSAT
QLMELAHSLGTPGFTLYASGRMLCGIVTDNNFTQETAMTMITPSSKLTLTKGNKSWSSTAVA
Predicted Coding Sequence 
XXCCCCCAGCTTGGAGGGAAAGGGCTTCCCCCGAACTGGAAATCCCTTCCACGTGAGGTAAGGAGAAAGCCCCCCCGTTTCCCGAAGGGA
GAAAAGGCGGACAGGTTTCCGTTAAGCGGCAGGGTCGGAACAAGAGAGCGCCCGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCTTTAT
AGCCCTGTCGGGTTTCXGCCACCCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACGCCAGCA
ACXGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGT
ATTACCCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCCA
ATACGCAAACCGCCTCTCCCCGCCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCA
ACGCAATTAATGGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCCGTATGTTGTGTGGAATTGTGACGGAT
AACAATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTCGAAATTAACCCTCACTAAAGGGAACAAAAGCTGGAGCTCCACC
GCGGTGGCG
Edits in Original Sequence 
(5')XXCCCCCAGCTTGGAGGGAAAGGGCTTCCCCCGAACTGGAAATCCCTTCCACGTGAGGTAAGGAGAAAGCCCCCCCGTTTCCCGAA
GGGAGAAAAGGCGGACAGGTTTCCGTTAAGCGGCAGGGTCGGAACAAGAGAGCGCCCGAGGGAGCTTCCAGGGGGAAACGCCTGGTATCT
TTATAGCCCTGTCGGGTTTCXGCCACCCTCTGACTTGAGCGTCGATTTTTGTGATGCTCGTCAGGGGGGCGGAGCCTATGGAAAAACGCC
AGCAACXGCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAA
CCGTATTACCgCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGAGCGAGGAAGCGGAAGAGC
GCCCAATACGCAAACCGCCTCTCCCCGCgCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTG
AGCGCAACGCAATTAATGtGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCtCGTATGTTGTGTGGAATTG
TGAgCGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTCGAAATTAACCCTCACTAAAGGGAACAAAAGCTGG
AGCTCCACCGCGGTGGCG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan