ESTScan Details for Unigene SGN-U334524

Score 
46
Direction 
Forward
Predicted Peptide Sequence 
MNPITIHWPAFYXRPDWENPGVTQLNRLGAHSPFRSWRNNEEAPHRSAFPKVAQPGWRMAN
Predicted Coding Sequence 
ATGAATCCTATTACCATTCACTGGCCGGCCTTTTACCAXCGTCCTGACTGGGAAAACCCTGGCGTTACCCAACTTAATCGGCTTGGAGCA
CATTCCCCTTTTCGCAGCTGGCGTAATAACGAAGAAGCGCCGCACCGATCCGCCTTTCCAAAAGTTGCGCAGCCTGGATGGCGAATGGCC
AATTGA
Edits in Original Sequence 
GTTTATGTGTTCCTAAAGGAGTTTATGGCAACAAACAATCATGCCCTTGTTACAACAATTGGAAGACTCAAGAAGGAAAACCTAAATGCC
CTTAATTAATTAAAATATTAATAATTAGGGAAATTAATCTTTTTTTCCCAATAATTAATGGAAAAGATTAAGAGTACTATAGCTATATGG
TCATATTGTGTTTTGTATTGCATTAAATTGATTTGGAGTAATTTTGATGTAATGTTTTAAGCATTTTGTATTTCTCTACTTGGGGTATCA
TGGTGTCTGAACTGAGTTGTAATACTGGAGCGATATATGATCTATGGATTAAGAATCATATAACCGGTTTCCACTTGCTCCGAAAAGAAA
TGGTATTGGAATCCTTCTTTTTTATAACCAAACTATAATAATAACTTATTTATTGG
(5')ATGAATCCTATTACCATTCACTGGCCGGCC
TTTTACCAXCGTCCTGACTGGGAAAACCCTGGCGTTACCCAACTTAATCGGCTTGGAGCACATTCCCCTTTTCGCAGCTGGCGTAATAAC
GAAGAAGCGCCGCACCGATCCGCCTTTCCAAAAGTTGCGCAGCCTGGATGGCGAATGGCCAATTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan