ESTScan Details for Unigene SGN-U334580

Score 
915
Direction 
Forward
Predicted Peptide Sequence 
SEDQIRKSYRDAALRHHPDKLASLLLAEETEAAKQAKKEEIENHFKAIQEAYEVLMDPVRRRIYDSTDEFDDEIPTECAPQDFFKVFGPA
FLRNGRWSVTQPIPSLGDENTPIKEVDSFYNFWYSFKSWREFPHADEFDLEQAESRDXQEVDGKAEAIRIVEEDKRKKEEEEKRAAEVAL
QQKKLKEKEKKLLRKERSRLRTLAAPVLSQRLLGLNDDDVESLCMSLDIEQLXNLCDKAMDRVKIVIAELLKGALGHX
Predicted Coding Sequence 
TCTGAGGATCAGATAAGGAAGAGCTATCGTGATGCTGCATTGAGGCATCATCCTGACAAGCTGGCTTCACTTCTTCTAGCTGAGGAAACT
GAAGCTGCAAAACAAGCCAAGAAGGAGGAAATAGAAAACCACTTCAAAGCTATTCAGGAAGCATATGAGGTTCTTATGGACCCTGTTAGG
AGAAGGATTTATGACTCCACGGATGAATTTGATGATGAAATCCCAACTGAATGTGCTCCACAAGATTTTTTTAAGGTCTTTGGACCTGCA
TTTTTAAGGAATGGTCGTTGGTCCGTCACCCAACCCATCCCTTCATTAGGTGATGAGAATACTCCAATTAAAGAAGTGGATAGCTTTTAT
AATTTCTGGTACAGCTTCAAAAGTTGGAGAGAGTTCCCACATGCTGATGAGTTTGATCTTGAACAAGCTGAATCTCGTGATXCACAAGAG
GTGGATGGAAAGGCAGAAGCAATTAGGATTGTTGAAGAGGACAAGCGTAAGAAAGAGGAAGAGGAGAAAAGAGCAGCTGAAGTTGCTTTG
CAGCAGAAGAAGTTGAAGGAGAAAGAAAAGAAATTGTTGCGAAAAGAGCGTAGTCGTTTAAGAACCCTTGCTGCTCCTGTTCTGTCTCAG
CGTTTGCTTGGGCTAAATGATGACGATGTAGAAAGTCTATGCATGTCACTTGACATTGAGCAACTGANGAACTTATGTGATAAAGCCATG
GACAGGGTGAAGATTGTTATTGCTGAACTTCTTAAGGGGGCACTTGGACATAXX
Edits in Original Sequence 
GCTTCTGAGGATCAGATAAGGAAGAGCTATCGTGATGCTGCATTGAGGCATCATCCTGACAAGCTGGCTTCACTTCTTCTAGCTGAG(5')
TCTGAGGATCAGATAAGGAAGAGCTATCGTGATGCTGCATTGAGGCATCATCCTGACAAGCTGGCTTCACTTCTTCTAGCTGAGGAAAC
TGAAGCTGCAAAACAAGCCAAGAAGGAGGAAATAGAAAACCACTTCAAAGCTATTCAGGAAGCATATGAGGTTCTTATGGACCCTGTTAG
GAGAAGGATTTATGACTCCACGGATGAATTTGATGATGAAATCCCAACTGAATGTGCTCCACAAGATTTTTTTAAGGTCTTTGGACCTGC
ATTTTTAAGGAATGGTCGTTGGTCCGTCACCCAACCCATCCCTTCATTAGGTGATGAGAATACTCCAATTAAAGAAGTGGATAGCTTTTA
TAATTTCTGGTACAGCTTCAAAAGTTGGAGAGAGTTCCCACATGCTGATGAGTTTGATCTTGAACAAGCTGAATCTCGTGATXCACAAGA
GGTGGATGGAAAGGCAGAAGCAATTAGGATTGTTGAAGAGGACAAGCGTAAGAAAGAGGAAGAGGAGAAAAGAGCAGCTGAAGTTGCTTT
GCAGCAGAAGAAGTTGAAGGAGAAAGAAAAGAAATTGTTGCGAAAAGAGCGTAGTCGTTTAAGAACCCTTGCTGCTCCTGTTCTGTCTCA
GCGTTTGCTTGGGCTAAATGATGACGATGTAGAAAGTCTATGCATGTCACTTGACATTGAGCAACTGANGAACTTATGTGATAAAGCCgA
TGGACAGGGTGAAGATTGTTATTGCTGAACTTCTTAAGGGGGCACTTGGACATAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan