ESTScan Details for Unigene SGN-U334600

Score 
176
Direction 
Forward
Predicted Peptide Sequence 
MSFYKNSSTMILKSGGPIYIQAGFFNGVTTAFTCKXVVKAENTLFPAHATLCDPPKGIPASNLSVAVNLTVPALNPWVKVFAVSMFFEKT
PAVRI
Predicted Coding Sequence 
ATGTCATTTTACAAAAACAGTAGTACTATGATTTTAAAATCAGGGGGCCCAATCTATATCCAAGCTGGATTCTTCAATGGAGTAACAACA
GCCTTTACTTGTAAGXTAGTTGTTAAGGCTGAAAATACCCTTTTCCCTGCCCATGCCACTCTCTGTGACCCTCCAAAAGGAATTCCAGCA
TCAAATTTATCXGTAGCAGTTAACCTCACCGTTCCAGCTCTAAATCCTTGGGTCAAGGTGTTTGCTGTGTCGATGTTTTTTGAGAAAACT
CCTGCTGTTAGAATATAA
Edits in Original Sequence 
CTACAGGACAACAACCAAATGAAGACTTTATTGATTGCTAACAACAATGTCATGTAAACAACCATGTCATTTTACAAAAACAGTAGTACT
ATGATTTTAAAATCAGGGGTGCCCAATCTATATCCAAGCTGGATTCTTCAATGGAGTAACAACAGCCTTTACTTGTAAGTAGTTGT
(5')
ATGTCATTTTACAAAAACAGTAGTACTATGATTTTAAAATCAGGGGtGCCCAATCTATATCCAAGCTGGATTCTTCAATGGAGTAACAAC
AGCCTTTACTTGTAAGXTAGTTGTTAAGGCTGAAAATACCCTTTTCCCTGCCCATGCCACTCaTCTGTGACCCTCCAAAAGGAATTCCAG
CATCAAATTTATCXGTAGCAGTTAACCTaCACCGTTCCAGCTCTAAATCCTTGGGTCAAGGTGTTTGCTGTGTCGATGTTTTTTGAGAAA
ACTCCTGCTGTTAGAATATAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan