ESTScan Details for Unigene SGN-U334601

Score 
204
Direction 
Reverse
Predicted Peptide Sequence 
MDNNKHPDPRIESLNEXGLNDXDIFDAGIPFGGYKMSGMGREKGIYSLNKYLQVKAVVTPLKNPAW
Predicted Coding Sequence 
ATGGACAATAACAAACACCCTGACCCGAGGATTGAGAGTTTGAACGAAGXTGGGTTAAATGATAXAGATATATTTGATGCTGGAATTCCT
TTTGGAGGGTACAAGATGAGTGGCATGGGCAGGGAAAAGGGTATTTACAGCCTTAACAAATACTTACAAGTGAAGGCTGTTGTTACTCCA
TTGAAGAATCCAGCTTGG
Edits in Original Sequence 
AAAAAAAAATTTCCACCCCTCATGGACAATAACAAACACCCTGACCCGAGGATTGAGAGTTTGAACGAAGTGGGTTAAATGATAAGATAT
ATTTGATGCTGGAATTCCTTTTGGAGGGTACAAGATGAGTGGCATGGGCAGGGAAAAGGGTATTTACAGCCTTAACAAATACTTACAAGT
GAAGGCTGTTGTTACTCCATTGAAGAATCCAGCTTGGATATAGATTGGGCACCCCTGATTTTAAAATCATAGTACTACTGTTTTTGTAAA
ATGACATGGTTGTTTACATGACATTGTTAGGGGCAATCAATAAAGTTTTCATTTGGTTGTTGTTTTGTAGAG
(5')ATGGACAATAACAA
ACACCCTGACCCGAGGATTGAGAGTTTGAACGAAGXTGGGTTAAATGATAXAGATATATTTGATGCTGGAATTCCTTTTGGAGGGTACAA
GATGAGTGGCATGGGCAGGGAAAAGGGTATTTACAGCCTTAACAAATACTTACAAGTGAAGGCTGTTGTTACTCCATTGAAGAATCCAGC
TTGG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan