ESTScan Details for Unigene SGN-U334620

Score 
358
Direction 
Forward
Predicted Peptide Sequence 
PTAAXNHLLVIFAKIKQPSSSVLRIELSFARTVTKQFIQPAASAKNHQRFLATGIRVALAQAVIRNQLSCITSPSWPVDDLLGFPDYESS
DKKDLLELGEFEWLGGIDLFGEQTAAEVPELSVPQSSNTNIYRTTKYQMPYKKSRIEIPDDDEYFTVPDLG
Predicted Coding Sequence 
CCAACTGCAGCCAXCAACCACCTCCTTGTGATATTTGCCAAGATAAAGCAGCCTTCATCTTCTGTGTTGAGGATAGAGCTCTCTTTTGCA
AGGACTGTGACGAAGCAATTCATTCAGCCAGCAGCCTCXGCTAAGAACCACCAACGCTTCTTAGCCACTGGAATCCGTGTAGCCTTGGCT
CAAGCTGTAATAAGGAATCAGTTGTCCTGTATAACATCACCATCTTGGCCTGTCGATGATTTACTAGGATTTCCAGATTATGAGTCGAGT
GACAAGAAGGATCTACTTGAGCTTGGTGAATTTGAGTGGTTAGGGGGCATTGATCTCTTTGGTGAACAAACAGCAGCTGAAGTGCCCGAG
CTATCAGTACCTCAGTCGAGCAATACAAATATTTACAGGACAACCAAATATCAAATGCCTTACAAGAAGTCCAGAATTGAAATCCCAGAT
GATGATGAGTATTTTACTGTCCCCGATCTTGGTTGA
Edits in Original Sequence 
GGGAATCAGTAAAAAACCAACTGCAGCCACAACCACCTCCTTGTGATATTTGCCAAGATAAAGCAGCCTTCATCTTCTGTGTTG(5')CC
AACTGCAGCCAXCAACCACCTCCTTGTGATATTTGCCAAGATAAAGCAGCCTTCATCTTCTGTGTTGAGGATAGAGCTCTCTTTTGCAAG
GACTGTGACGAAGCAATTCATTCAGCCAGCAGCCTCXGCTAAGAACCACCAACGCTTCTTAGCCACTGGAATCCGTGTAGCCTTGaGCTC
AAGCTGTAATAAGGAATCAGTTGTCCTGTATAACATCACCATCTTGGCCTGTCGATGATTTACTAGGATTTCCAGATTATGAGTCGAGTG
ACAAGAAGGATCTACTTGAGCTTGGTGAATTTGAGTGGTTAGGGGGCATTGATCTCTTTGGTGAACAAACAGCAGCTGAAGTGCCCGAGC
TATCAGTACCTCAGTCGAGCAATACAAATATTTACAGGACAACCAAATATCAAATGCCTTACAAGAAGTCCAGAATTGAAATCCCAGATG
ATGATGAGTATTTTACTGTCCCCGATCTTGGTTGA(3')TCATACTGTCAACAGATATGTTCAGTAAGTAGAAAAAGTATTGTTCTGCTT
AAGATACTCCTTATCTTGCTTACTTTCGCAGTGCGCTCATATTGTCAACAGACATGTTCAGTAAGTAGAGGAAACACTATTCTGCTTAAG
ATATCCTTTATCTTGCTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan