ESTScan Details for Unigene SGN-U334725

Score 
159
Direction 
Reverse
Predicted Peptide Sequence 
MQILRHRTYRSKSPGYNLHYMVDFKATITKGSQQLTRHDRLPDXVKNEASQNGRAXSKKKKKGKGKGKEKEDNYVKPRAEFLQPGGSTSS
RAAATAVELKGCHNTRVSK
Predicted Coding Sequence 
ATGCAAATTCTAAGGCATAGAACTTACAGATCAAAAAGCCCTGGGTATAATCTTCATTACATGGTGGACTTCAAAGCTACAATTACAAAA
GGATCACAACAGCTAACACGGCACGACAGACTTCCTGATXCTGTGAAGAATGAAGCAAGTCAAAATGGTAGAGCTXCATCAAAGAAGAAG
AAAAAAGGAAAAGGAAAAGGAAAAGAAAAAGAGGATAATTATGTGAAGCCTCGTGCCGAATTCCTGCAGCCCGGGGGATCCACTAGTTCT
AGAGCGGCCGCCACCGCGGTGGAGCTCAAGGGTTGTCATAATACCAGGGTTTCCAAG
Edits in Original Sequence 
TTTTCGTAAATGAAAGTAATGTAATCCAGCAAGTATCAGGTTTTATGTCCCTTAGCTCACCACTCTCTTGCTTAAGAACTTATATGCAAG
TCCTGATTACTTGTAAATGGTTTTGTAGCAGAACTATTTAATAGAAACATTGACATTCAAGGAGTAGTTGCTTCTTTAGAAAATTATGAG
AAAAAGTAGGCTCGTTGTTTATCAAAGGCAAGTCGTAAATCATTAAGATGCAAGAAAACTAGTTCCTCCAAGATACAGTTCTAGCTTCAG
TTAGCGACTGCAAATTATTGAAAGAAGTCGAATTAAAGAATCCTATTTTCCTATTTATTTAAAACATTATATGGAAAAAAAAAATTGTTA
ACTAGGTATAGAAAAGGAAAATGCAAATTCTAAGGCATAGAACTTACAGATCAAAAAGCCCTGGGTATAATCTTCATTACATGGTGGACT
TCAAAGCTACAATTACAAAAGGATCACAACAGCTAACACGGCACGACAGACTATCCTGATCTGTGAAGAATGAAGCAAGTCAAAATGG
(5')
ATGCAAATTCTAAGGCATAGAACTTACAGATCAAAAAGCCCTGGGTATAATCTTCATTACATGGTGGACTTCAAAGCTACAATTACAA
AAGGATCACAACAGCTAACACGGCACGACAGACTaTCCTGATXCTGTGAAGAATGAAGCAAGTCAAAATGGTAGAGCTXCATCAAAGAAG
AAGAAAAAAGGAAAAGGAAAAGGAAAAGAAAAAGAGGATAATTATGTGAgAGCCTCGTGCCGAATTCCTGCAGCCCGGGGGATCCACTAG
TTCTAGAGCGGCCGCCACCGCGGTGGAGCTCAAGGGTTGTCATAATACCAGGGTTTCCAAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan