ESTScan Details for Unigene SGN-U334730

Score 
-42
Direction 
Forward
Predicted Peptide Sequence 
TIHWPAFYNVVTGKNLAFPNLIALQHIPLFASLRNTE
Predicted Coding Sequence 
ACAATTCACTGGCCGGCGTTTTACAACGTCGTGACTGGGAAAAACCTTGCGTTTCCCAACTTAATCGCCTTGCAGCACATTCCCCTTTTC
GCCAGCTTGCGTAATACCGAATAG
Edits in Original Sequence 
ATTTCACCTACCAAACTTTAACTACACAGACTACTATTTCACATATATCAAGAGAGCAAATATTGAGACAGAAAGATGGCAAATACGGAG
CTGCTGGTGTTTGCAATGGAGGGGGAGGTGCCTCGGCCCTTGTTGTAGAACTTATGTAATACATTTCTTCAGTCCTTTGGTGAGAATTGC
AAGCTTAGTTACAAGAGATGGAGTTTCAATGGTTGATTAGATTGAGTGGTTGGTGTCTTTAAGTAGAAGATTGTTAAATTTTTCTATCTT
CTTCCAAGCATTTGTAGTCTTCACATATAAATAAATGTAATAGTGATTACTTTCCTAAAAGAGCTCTTTTCCTTCT
(5')ACAATTCACT
GGCCGGCGTTTTACAACGTCGTGACTGGGAAAAACCTTGCGTTTCCCAACTTAATCGCCTTGCAGCACATTCCCCTTTTCGCCAGCTTGC
GTAATACCGAATAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan