ESTScan Details for Unigene SGN-U334791

Score 
-28
Direction 
Reverse
Predicted Peptide Sequence 
YFKGGPSPGEWQNPKASATPKQGKKALKTKNEEMGLLTPPRXKKFAEILKGGPPGKQGPTNFNLKKGGLMALGPNPWGXGFLGMGKAPXL
GGPISKDVLKAEFPVANLKRGALKESKVGRHGLIMEGPVKQANPEKNPKVAFLKANINKATKVGTKRSVSSVPAIGFIKNGKEGDGAEGP
DKNSLEKEDAQHAG
Predicted Coding Sequence 
TATTTTAAGGGGGGCCCCTCACCCGGGGAATGGCAAAACCCAAAGGCATCTGCAACCCCTAAACAAGGAAAAAAAGCCCTTAAAACCAAA
AATGAGGAAATGGGTCTCCTTACACCCCCAAGAGAXAAAAAGTTTGCAGAAATATTAAAAGGCGGCCCCCCAGGGAAACAAGGGCCTACA
AATTTCAACCTGAAGAAAGGGGGATTAATGGCCCTGGGCCCCAACCCTTGGGGCXCCGGTTTCCTTGGAATGGGAAAAGCCCCCXCCCTA
GGGGGCCCAATATCAAAAGATGTTTTAAAAGCCGAATTCCCGGTCGCCAACTTAAAAAGAGGGGCCCTAAAGGAATCGAAAGTTGGAAGG
CACGGGCTCATCATGGAAGGCCCGGTTAAACAAGCCAACCCXGAAAAAAATCCAAAAGTTGCATTTTTAAAGGCTAATATCAATAAGGCT
ACAAAAGTGGGTACAAAAAGGAGCGTCAGTAGTGTGCCAGCTATCGGTTTCATAAAAAATGGCAAAGAGGGCGACGGGGCCGAAGGTCCT
GACAAGAATTCCCTGGAAAAAGAAGATGCCCAGCATGCAGGCTAA
Edits in Original Sequence 
CAAGAATTCCCTGGAAAAAGAAGATCGCCCAGCATG(5')TATTTTAAGGGGGGCCCCTCACCCGGGGAATGGCAAAACCCAAAGGCATC
TGCAAcCCCCTAAACAAGGAAAAAAAGCCCTTAAAACCAAAAATGAGGAAATGGGTCTCCTTACACCCCCAAGAGAXAAAAAGTTTGCAG
AAATATTAAAAGGCGGCCCCCCAGGGAAACAAGGGCCTACAAATTTCAACCTGAAGAAAGGGGGATTAATGGCCCTGGGCCCCAACCCTT
GGGGCXCCGGTTTCCTTGGAATGGGAAAAGCCCCCXCCCTAGGGGGCCCAATATCAAAAGATGTTTTAAAAGCCGAATTCCCGGTCGCCA
ACTTAAAAAGAGGGGCCCTAAAGGAATCGAAAGTTGGAAGGCACGGGCTCATCATGGAAGGCCCGGTTAAACAAGCCAACCCXGAAAAAA
ATCCAAAAGTTGCATTTTTAAAGGCTAATATCAATAAGGCTACAAAAGTGGGTACAAAAAGGAGCGTCAGTAGTGTGCCAGCTATCGGTT
TCATAAAAAATGGCAAAGAGGGCGACGGGGCCGAAGGTCCTGACAAGAATTCCCTGGAAAAAGAAGATcGCCCAGCATGCAGGCTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan