ESTScan Details for Unigene SGN-U334854

Score 
802
Direction 
Forward
Predicted Peptide Sequence 
MASLSKFLKKRSLNYNNVDLMRAASNRLFSTQLPHTNIKSEVSQLIGKTPMVYLKKVTKGCGAYIAVKQEMFHPTSSIKDRPALAMINDA
KKKGLISPEKTTLIDPTSGNMGISMAFMAAMKGYKMVLTMPSYTTMERKVTMKAFGANLILTDPTKGMGGTVKKAYDLLKSTPNAFMLQQ
FSNPANTQIYGLEPTESNILNGGKPGPHHITGNGVGFKPDILDMDLMEEVLMVSSEDAVNMARELAVKEGLMVGISSGAXTVAALNYSKT
KNKGKLIGTVHAKFGERYLSSCVYQKLRKEPEXLATISAD
Predicted Coding Sequence 
ATGGCAAGTTTAAGCAAATTCTTGAAAAAAAGATCATTAAATTATAATAATGTTGATTTGATGAGAGCAGCTAGCAACAGATTGTTCTCT
ACACAACTTCCTCATACTAACATCAAGTCTGAAGTTTCTCAATTAATTGGGAAAACACCAATGGTTTATCTTAAAAAAGTGACAAAAGGA
TGTGGAGCCTATATAGCTGTGAAACAGGAAATGTTTCACCCTACTTCTAGCATCAAAGACAGACCAGCATTGGCAATGATCAATGATGCA
AAAAAAAAAGGCTTAATATCACCTGAAAAGACAACGTTGATTGACCCAACATCAGGAAATATGGGGATCAGTATGGCATTTATGGCAGCA
ATGAAAGGCTACAAAATGGTTTTGACTATGCCATCGTACACGACCATGGAGAGGAAAGTGACAATGAAAGCATTTGGAGCCAACTTAATC
CTCACCGATCCAACCAAAGGAATGGGAGGCACTGTTAAAAAGGCTTATGATCTTTTGAAATCGACACCTAATGCTTTCATGCTTCAACAA
TTTTCCAACCCCGCAAACACTCAAATATATGGACTTGAGCCAACTGAAAGCAATATACTGAATGGTGGAAAACCAGGTCCTCATCATATA
ACGGGAAATGGGGTCGGGTTCAAGCCAGATATCCTTGATATGGATCTAATGGAGGAAGTACTAATGGTTTCTAGCGAAGACGCTGTAAAC
ATGGCTAGGGAGTTGGCAGTGAAGGAAGGACTCATGGTTGGAATATCGTCGGGAGCTXATACAGTAGCAGCTCTTAACTACTCAAAAACC
AAAAACAAAGGCAAACTCATAGGGACTGTACATGCAAAGTTTGGTGAGCGATACTTATCATCGTGTGTGTATCAAAAACTGAGAAAAGAG
CCTGAAAAXTTGGCAACCATTTCAGCCGATTAA
Edits in Original Sequence 
GAATGTGAGGTACACAAAAAAAAAAGGTCAATTGCATAGAGAGTACCTTTTTTTGTGTAAAATTTAAAGTGCAATAATTTTGAAAAATTC
ATCAATGGCAAGTTTAAGCAAATTCTTGAAAAAAAGATCATTAAATTATAATAATGTTGATTT
(5')ATGGCAAGTTTAAGCAAATTCTT
GAAAAAAAGATCATTAAATTATAATAATGTTGATTTGATGAGAGCAGCTAGCAACAGATTGTTCTCTACACAACTTCCTCATACTAACAT
CAAGTCTGAAGTTTCTCAATTAATTGGGAAAACACCAATGGTTTATCTTAAAAAAGTGACAAAAGGATGTGGAGCCTATATAGCTGTGAA
ACAGGAAATGTTTCACCCTACTTCTAGCATCAAAGACAGACCAGCATTGGCAATGATCAATGATGCAAAAAAAAAAGGCTTAATATCACC
TGAAAAGACAACGTTGATTGACCCAACATCAGGAAATATGGGGATCAGTATGGCATTTATGGCAGCAATGAAAGGCTACAAAATGGTTTT
GACTATGCCATCGTACACGACCATGGAGAGGAAAGTGACAATGAAAGCATTTGGAGCCAACTTAATCCTCACCGATCCAACCAAAGGAAT
GGGAGGCACTGTTAAAAAGGCTTATGATCTTTTGAAATCGACACCTAATGCTTTCATGCTTCAACAATTTTCCAACCCCGCAAACACTCA
AATATATGGACTTGAGCCAACTGAAAGCAATATACTGAATGGTGGAAAACCAGGTCCTCATCATATAACGGGAAATGGGGTCGGGTTCAA
GCCAGATATCCTTGATATGGATCTAATGGAGGAAGTACTAATGGTTTCTAGCGAAGACGCTGTAAACATGGCTAGGGAGTTGGCAGTGAA
GGAAGGACTCATGGTTGGAATATCGTCGGGAGCTXATACAGTAGCAGCTCTTAACTAgCTCAAAAACCAAAAACAAAGGCAAACTCATAG
GGACTGTACATGCAAAGTTTGGTGAGCGATACTTATCATCGTGTGTGTATCAAAAACTGAGAAAAGAGCCTGAAAAXTTGGCAACCATTT
CAGCCGATTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan