ESTScan Details for Unigene SGN-U334942

Score 
-277
Direction 
Reverse
Predicted Peptide Sequence 
IFEKALQGGGAYGKNPSNAAFFRFCPFGCLFVHMFFPALSPDSVDTRITPLSELIPLAAAERPSAAESVSEEAEERPIRKPPLPAVGRFI
NAAGTTGFPTGKRAVSATQLMELAHSLGTPGFTLYASGRMLCGIVTDNNFTQETAMTMITPSSKLTLTKGNKSWSSTAVAAALELVDPRA
AGIXARGSKEEVFAQIDGALTQLLEAKXLKIWIRNVIESRKNLQNVPCNTXGGSSKTRVTLLVAIPLIQMYEMFMYIVFASNYLCGYSLN
QFKVYYKTCFVEGLTASDIVSFELTPMRLKMRH
Predicted Coding Sequence 
ATTTTTGAGAAGGCTCTCCAGGGGGGGGGAGCCTATGGGAAAAACCCCAGCAACGCGGCTTTTTTCCGTTTCTGCCCTTTTGGCTGCCTT
TTTGTTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATACCCGTATTACCCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCC
GAACGACCGAGCGCAGCXGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCCGTTGGCCGATTCATT
AATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGGAGTTAGCTCACTCATTAGGCACCCCA
GGCTTTACACTTTATGCTTCCGGCCGTATGTTGTGTGGAATTGTGACGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACG
CCAAGCTCGAAATTAACCCTCACTAAAGGGAACAAAAGCTGGAGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCGGGCT
GCAGGAATTCXGGCACGAGGTTCTAAAGAGGAGGTATTTGCTCAAATTGATGGTGCATTAACTCAACTTCTTGAAGCAAAGGAXTTGAAG
ATTTGGATCCGTAATGTCATAGAGAGCAGGAAAAATCTGCAGAATGTACCATGTAATACTGXAGGAGGATCATCGAAGACAAGAGTCACA
TTGTTGGTTGCTATCCCTCTTATACAAATGTATGAAATGTTTATGTATATCGTATTTGCTTCCAACTATTTATGTGGATATTCATTGAAT
CAGTTCAAAGTTTACTACAAAACTTGTTTTGTTGAAGGCCTAACTGCTAGTGATATTGTTAGCTTTGAGCTTACACCTATGCGGCTTAAG
ATGCGTCATTAG
Edits in Original Sequence 
(5')ATTTTTGtAGAAGGCTCTCCAGGGGGGGGGAGCCTATGGGAAAAACCCCAGCAACGCGGcCTTTTTTCCGTTTCTGCCCTTTTGGC
TGCCTTTTTGTTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATACCCGTATTACCgCCTTTGAGTGAGCTGATACCGCTCGC
CGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCCAATACGCAAACCGCCTCTCCCCGCgCGTTGGCC
GATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACGCAATTAATGtGAGTTAGCTCACTCATTA
GGCACCCCAGGCTTTACACTTTATGCTTCCGGCtCGTATGTTGTGTGGAATTGTGAgCGGATAACAATTTCACACAGGAAACAGCTATGA
CCATGATTACGCCAAGCTCGAAATTAACCCTCACTAAAGGGAACAAAAGCTGGAGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAGTGG
ATcCCCCGGGCTGCAGGAATTCXGGCACGAGGTTCTAAAGAGGAGGTATTTGCTCAAATTGATGGTGCATTAACTCAACTTCTTGAAGCA
AAGGAXTTGAAGATTTGGATCCGTAATGTCATAGAGAGCAGGAAAAATCTGCAGAATGTACCATGTAATACTGXAGGAGGATCATCGAAG
ACAAGAGTCACATTGTTGGTTGCTATCCCTCTTATACAAATGTATGAAATGTTTATGTATATCGTATTTGCTTCCAACTATTTATGTGGA
TATTCATTGAATCAGaTTCAAAGTTTACTACAAAACTTGTTTTGTTGtAAGGCCTAACTcGCTAGTGATATTGTTAGCTTTGAGCTTACA
CCTATGCGGCtTTAAGATGCGTCATTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan