ESTScan Details for Unigene SGN-U334945

Score 
-416
Direction 
Forward
Predicted Peptide Sequence 
RSXLSRYDTLLEPIGGADALELVDPRAAGPDQQLQLTGALVPVRFNKVNYANVSTNNYALDEIEEGEMRTYALNWNKYIICRMQGPLVFS
CLFSSYIQALNVNECLIIKKKKKNSRGGPDPIRPIVSRITIHWPSFYNVVTGKTLALPNXNRLAAHPPFASWRNSEEARTDRPSQQLRSL
NGEWQIVSVNILLKFALIFVKSGHIVTNKPKSAKSLINQKTRPEIGLSGVQFGTRVTIKNVGLTVKGEKPLLGRCPYWNIPLISFGVSAE
TLNGXLRDPVLFLGKRHCGRKEKQ
Predicted Coding Sequence 
XXGAGGTCTNGGCTTTCCCGCTATGATACTCTCTTAGAGCCCATCGGAGGTGCTGACGCTCTAGAACTAGTGGATCCCCGGGCTGCAGGT
CCTGATCAACAGCTACAACTGACCGGTGCCCTTGTACCAGTAAGATTCAACAAAGTGAATTATGCTAATGTTTCAACCAACAACTATGCA
TTGGATGAAATTGAAGAAGGTGAAATGAGAACGTATGCCCTCAATTGGAATAAGTATATTATTTGTAGAATGCAAGGCCCTTTGGTTTTT
TCATGTTTATTCTCTAGTTATATACAGGCTTTGAATGTGAATGAGTGTCTTATTATAAAAAAGAAAAAAAAAAACTCGAGGGGGGGCCCG
GACCCAATTCGCCCTATAGTGAGTCGTATTACAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAAC
TTXAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGTACCGATCGCCCTTCCCAACAGTTGCGCAGC
CTGAATGGCGAATGGCAAATTGTAAGCGTTAATATTTTGTTAAAATTCGCGTTAATTTTTGTTAAATCAGGTCATATTGTAACCAATAAG
CCGAAATCGGCAAAATCCCTTATAAATCAAAAGACTAGACCXGAGATAGGCTTGAGTGGTGTTCAGTTTGGAACAAGAGTCACTATTAAG
AACGTTGGACTCACXGTCAAAGGCGAAAAACCGTTATTAGGGCGATGCCCATACTGGAACATTCCCCTAATAAGTTTTGGGGTCAGTGCG
GAAACACTAAATGGAAXCCTAAGGGACCCCGTTTTATTTTTGGGGAAGCGCCACTGTGGAAGGAAGGAGAAACAATGA
Edits in Original Sequence 
(5')XXGAGGTCTNGGCTTTCCCgGCTATGATACTCTCTTAGAGCCCATCGGAGGTGCTGACGCTCTAGAACTAGTGGATcCCCCGGGCT
GCAGGTCCTGATCAACAGCTACAACTGaACCGGTGCCCTTGTACCAGTAAGATTCAACAAAGTGAATTATGCTAATGTTTCAACCAACAA
CTATGCATTGGATGAAATTGAAGAAGtGTGAAATGAGAACGTATGCCCTCAATTGGAATAAGTATATTATTTGTAGAATGCAAGGCCCTT
TGGTTTTTTCATGTTTATTCTCTAGTTATATACAGGCTTTGAATGTGAATGAGTGTCTTATTATAAAAAAGAAAAAAAAAAACTCGAGGG
GGGGCCCGGtACCCAATTCGCCCTATAGTGAGTCGTATTACAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCG
TTACCCAACTTXAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGTACCGATCGCCCTTCCCAACAG
TTGCGCAGCCTGAATGGCGAATGGCAAATTGTAAGCGTTAATATTTTGTTAAAATTCGCGTTaAATTTTTGTTAAATCAGGTCATATTGT
AACCAATAAGCCGAAATCGGCAAAATCCCTTATAAATCAAAAGACTAGACCXGAGATAGGCTTGAGTGGTGTTCAGTTTGGAACAAGAGT
CACTATTAAGAACGTTGGACTCACXGTCAAAGGCGAAAAACCGTTATTAGGGCGATGCCCATACTGGAACATTCCCCTAATAAGTTTTGG
GGTCAGTGCGGAAACACTAAATGGAAXCCTAAGGGACCCCGTTTTATTTTTGGGGAAGCGCCACTGTGGAAGGAAGGAGAAACAATGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan