ESTScan Details for Unigene SGN-U335004

Score 
-259
Direction 
Reverse
Predicted Peptide Sequence 
KADRVSGKGRVEPXERPRELPGGNAWIFLVLWGSAPSDLSVDFCDVRQGGGAMEKRQQRRPFYGSWPFAGPFAHMFFPALSPDSVDNRIT
PLSELIPLAAAERPSAAESVSEEAEERPIRKPPLPAVGRFINAAGTTGFPTGKRAVSATQLMELAHSLGTPGFTLYASGRMLCGIVTDNN
FTQETAMTMITPSSKLTLTKGNKSWSSTAVAAAXRTSGSPGLQEFGRGEEQLLAEXIILSAIFLFSYIGGPPHFPLKMTTSRRLADRKVE
RFEKNITKRGAVPETTAKKGSQYPVGPILLGVFVFVVIGSSLFQIIRTATSGGVFKACKVIQVVAPAL
Predicted Coding Sequence 
XXGAAAGCGGACCGGGTTTCCGGTAAGGGCAGGGTCGAACCAGXGGAGCGCCCGAGGGAGCTTCCAGGGGGAAACGCCTGGATCTTTTTA
GTCCTGTGGGGTTCCGCCCCCTCTGACTTGAGCGTCGATTTTTGTGATGTTCGTCAGGGGGGCGGAGCTATGGAAAAACGCCAGCAACGX
CGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGXCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCGTATT
ACCCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCCCAATA
CGCAAACCGCCTCTCCCCGCCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGCGCAACG
CAATTAATGGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCCGTATGTTGTGTGGAATTGTGACGGATAAC
AATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTCGAAATTAACCCTCACTAAAGGGAACAAAAGCTGGAGCTCCACCGCG
GTGGCGGCCGCTXCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCAGAGGGGAGGAACAACTTTTAGCTGAAATXATAATTCTC
TCTGCAATTTTTCTGTTCTCATATATCGGCGGXCCACCACATTTTCCTTTAAAAATGACTACATCAAGGCGTCTTGCTGATAGGAAGGTG
GAGAGGTTTGAGAAAAATATTACCAAGCGAGGAGCTGTTCCTGAAACTACTGCAAAGAAGGGAAGCCAGTATCCAGTTGGCCCTATCTTG
CTTGGAGTCTTCGTCTTTGTTGTCATTGGCTCATCTTTGTTCCAGATAATAAGGACAGCAACCAGCGGGGGTGTGTTTAAGGCTTGCAAA
GTTATACAAGTAGTGGCGCCTGCATTGTAG
Edits in Original Sequence 
(5')XXGAAAGCGGACCGGGTTTCCGGTAAGGGCAGGGTCGAACCAGXGGAGCGCCCGAGGGAGCTTCCAGGGGGAAACGCCTGGATCTT
TTTAGTCCTGTGGGGTTCCGCCCCCTCTGACTTGAGCGTCGATTTTTGTGATGTTCGTCAGGGGGGCGGAGCTATGGAAAAACGCCAGCA
ACGXCGGCCTTTTTACGGTTCCTGGCCTTTTGCTGGXCCTTTTGCTCACATGTTCTTTCCTGCGTTATCCCCTGATTCTGTGGATAACCG
TATTACCgCCTTTGAGTGAGCTGATACCGCTCGCCGCAGCCGAACGACCGAGCGCAGCXGAGTCAGTGAGCGAGGAAGCGGAAGAGCGCC
CAATACGCAAACCGCCTCTCCCCGCgCGTTGGCCGATTCATTAATGCAGCTGGCACGACAGGTTTCCCGACTGGAAAGCGGGCAGTGAGC
GCAACGCAATTAATGtGAGTTAGCTCACTCATTAGGCACCCCAGGCTTTACACTTTATGCTTCCGGCtCGTATGTTGTGTGGAATTGTGA
gCGGATAACAATTTCACACAGGAAACAGCTATGACCATGATTACGCCAAGCTCGAAATTAACCCTCACTAAAGGGAACAAAAGCTGGAGC
TCCACCGCGGTGGCGGCCGCTXCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCAcGAGGGGAGGAACAACTTTTAGCTGAAAT
XATAATTCTCTCTGCAATTTTTCTGTTCTCATATATCGGCGGXCCACCACATTTTCCTTTAAAAATGACTACATCAAGGCGTCTTGCTGA
TAGGAAGGTGGAGAGGTTTGAGAAAAATATTACCAAGCGAGGAGCTGTTCCTGAAACTACTGCAAAGAAGGGAAGCCAGTATCCAGTTGG
CCCTATCTTGCTTGGAGTCTTCGTCTTTGTTGTCATTGGCTCATCTTTGTTCCAGATAATAAGGACAGCAACCAGCGGGGGTGTGTTTAA
GGCTTGCAAAGTTATACAAGTAGTGGCGCCTGCATTGTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan