ESTScan Details for Unigene SGN-U335032

Score 
447
Direction 
Forward
Predicted Peptide Sequence 
MENHWSSTAVAAALELVDPRAAGFVQIFFIYLALTPSRTTVKPAAKETEKMPGIKGPSDYSREPPRHPSLKINAXGKINIKGYALSGGGX
WHIKGRRVYDGGKTWEEATRYQRTGVPYIADDSSSDRWAWVFFEAEADIPHSAEILAKAVDICANGQSAFKEATVVDTGTPEPLGNMSHE
QPSWAIWVTEDMGPASLEERSGIEPGTFCDRLRGILSQAGGPLFGLIALESKSKGSKEAPGKTGNEPGSKHFKAFGKVENLVSTFWHSPA
QVFTFFSPCGTLPIMGAGTHKPT
Predicted Coding Sequence 
ATGGAGAACCACTGGAGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCGGGCTGCAGGATTTGTACAAATCTTCTTCATC
TACCTCGCACTCACACCTAGCAGGACTACTGTGAAGCCGGCGGCAAAGGAAACTGAGAAAATGCCTGGGATTAAAGGGCCTTCCGATTAT
TCGCGAGAACCCCCTCGCCATCCTTCTCTTAAAATTAATGCCAXTGGAAAGATAAACATCAAGGGGTACGCATTATCAGGAGGTGGGCXG
TGGCATATAAAGGGTAGACGTGTCTATGATGGTGGTAAAACTTGGGAGGAAGCCACCAGATACCAGAGAACTGGTGTTCCATATATTGCT
GATGATTCAAGCAGTGACAGATGGGCATGGGTCTTTTTTGAAGCTGAGGCAGATATTCCCCACAGTGCGGAAATACTTGCTAAAGCGGTG
GATATATGTGCAAATGGTCAATCTGCTTTCAAGGAAGCAACTGTTGTTGACACGGGGACACCAGAACCTCTGGGGAACATGAGTCATGAA
CAACCAAGTTGGGCGATTTGGGTGACTGAGGATATGGGCCCTGCCAGTCTTGAAGAAAGAAGCGGAATAGAGCCTGGTACCTTTTGTGAC
CGTCTACGGGGAATATTGAGCCAAGCGGGTGGCCCACTTTTTGGCTTGATTGCGTTGGAATCCAAATCGAAGGGCTCAAAAGAAGCTCCC
GGAAAAACGGGAAACGAACCTGGCTCAAAACATTTCAAAGCCTTTGGAAAAGTAGAAAACCTTGTTTCCACATTTTGGCATTCCCCCGCC
CAAGTTTTTACCTTCTTTTCTCCTTGTGGCACATTGCCAATAATGGGCGCTGGGACTCATAAGCCCACT
Edits in Original Sequence 
TTTGTACAAAT(5')ATGGAGAACCACTGGAGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATcCCCCGGGCTGCAGGATTTGT
ACAAATCTTCTTCATCTACCTCGCACTCACACCTAGCAGGACTACTGTGAAGCCGGCGGCAAAGGAAACTGAGAAAATGCCTGGGATTAA
AGGGCCTTCCGATTATTCGCGAGAACCCCCTCGCCATCCTTCTCTTAAAATTAATGCCAXTGGAAAGATAAACATCAAGGGGTACGCATT
ATCAGGAGGTGGGCXGTGGCATATAAAGGGTAGACGTGTCTATaGATGGTGGTAAAACTTGGGAGGAAGCCACCAGATACCAGAGAACTG
GTGTTCCATATATTGCTGATGATTCAAGCAGTGACAGATGGGCATGGGTCTTTTTTGAAGCTGAGGCAGATATTCCCCACAGTGCGGAAA
TACTTGCTAAAGCGGTGGATATATGTGCAAATGGTCAATCTGCTTTCAAGGAAGCAACTGTTGTTGACACGGGGACACCAGAACCTCTGG
GGAACATGAGTCATGAACAACCAAGTTGGGCGATTTGGGTGACTGAGGATATGGGCCCTGCCAGTCTTGAAGAAAGAAGCGGAATAGAGC
CTGGTACCTTTTGTGACCGTCTACGGGGAATATTGAGCCgAAGCGGGTGGCCCACTTTTTGGCTTGATTGCGTTGGAATCCAAATCGAAG
GGCTCAAAAGAAGtCTCCCGGAAAAACGGGAAACGAACCTGGCTCAAAACATTTCAAAGCCTTTGGAAAAGTAGAAAACCTTGTTTCCAC
ATTTTGGCATTCCCCCGCCCaAAGTTTTTACCTTCTTTTCTCCTTGTGGCACATTGCCAATAATGGGCGCTGGGACTCATAAGCCCACT
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan