ESTScan Details for Unigene SGN-U335044

Score 
-279
Direction 
Forward
Predicted Peptide Sequence 
MVIAVSCVKLLSLTIPHNIRAGSINVKPGVPNDELTHINCVALTARFPVGKPVVPAAINESANAAGRGGLRIGRSSASSLTXLAALGRSA
AAAVSAPSKAGNTVIPKNRGNNAGKKMVRKRPAKGPRNPKKXAPVAWAFFQKGP
Predicted Coding Sequence 
ATGGTCATAGCTGTTTCCTGTGTGAAATTGTTATCCCTCACAATTCCACACAACATACGAGCCGGAAGCATAAATGTAAAGCCTGGGGTG
CCTAATGATGAGCTAACTCACATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCXATTAATGAA
TCGGCCAACGCXGCGGGGAGAGGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGAXCTCGCTGCGCTCGGTCGTTCGGCT
GCGGCGGCGGTATCAGCTCCCTCAAAGGCGGGTAATACGGTTATCCCAAAAAATCGGGGGAATAACGCAGGAAAGAAAATGGTGAGAAAA
AGGCCAGCCAAAGGGCCAAGGAACCCGAAAAAAGXGGCCCCCGTTGCCTGGGCCTTTTTCCAAAAGGGCCCC
Edits in Original Sequence 
TTTTTTTTTTTTTTTTTGGTTCAAGTACATCTCCAAAATCCTTATAAGCGAATATTAGTCCATACAGAAATTGACAAGTTCCATTACCTA
GGAGTAATTTAAAACAGAAATCAACCCAACCCACTCGGGAAGAATTTAATTGTCTTCCTTCCAAAATTATTACAGGGCTCTAAATACTTC
ATGGTACAAACTTTGGGCGTGGCCTGCCCCACTCATCATCATGCAAATGGAACTCTTTGACGATGCCTTTGTAAACCAATACAGGGATTG
CGATACCGAAGATACCTACAATCGCTAGGTTTCGTCGAGTCCAACGAAAGTTGAGCTCCAGATTCTCCCTTGCGGCTCCCCATTCTTCGA
TCCACTTGTTCTTGTTGTACTCCATTCCCCCACCCATTTTTCCTCTCTCGTCTTCAGCTTTG
(5')ATGGTCATAGCTGTTTCCTGTGTG
AAATTGTTATCCgCTCACAATTCCACACAACATACGAGCCGGAAGCATAAAgTGTAAAGCCTGGGGTGCCTAATGAgTGAGCTAACTCAC
ATTAATTGCGTTGCGCTCACTGCCCGCTTTCCAGTCGGGAAACCTGTCGTGCCAGCTGCXATTAATGAATCGGCCAACGCXGCGGGGAGA
GGCGGTTTGCGTATTGGGCGCTCTTCCGCTTCCTCGCTCACTGAXCTCGCTGCGCTCGGTCGTTCGGCTGCGGCGaGCGGTATCAGCTCC
CTCAAAGGCGGGTAATACGGTTATCCCAAAAAATCGGGGGAATAACGCAGGAAAGAAAATGGTGAGAAAAAGGCCAGCCAAAGGGCCAAG
GAACCCGAAAAAAGXGGCCCCCGTTGCCTGGGCCTTTTTCCAAAAGGGCCCC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan