ESTScan Details for Unigene SGN-U335140

Score 
-79
Direction 
Forward
Predicted Peptide Sequence 
GITLIAFAAITYLLSFALKFVAFRNLIYSAGPNRCVYREIEGFSALYGNLSEKKSLDLTGFTWYDYHALLVNPNSLSASSSNLINEDEKD
NXKANENFLGSAFTPRASTEKCPFFVEVXNLSFPLLPVADFVEKHLFRKLHDLLDLGSVLKVSLFFLVLVVISITLFDLTLSFPYYIWSK
FDKCKTKNLISIVEIYVVTLSDLLNRTXXGTIYVYKKKKKNSKGGPVPNSPYRRRIXIHWPAVYNVVTGKTLALPTLIPLQKFPFWPLAY
YRKRPAPMALPKX
Predicted Coding Sequence 
GGTATCACTCTCATCGCATTTGCAGCAATTACATATCTTCTCTCTTTTGCTCTCAAATTTGTTGCATTTAGGAATTTAATTTACTCCGCT
GGCCCGAATCGATGTGTATACCGTGAAATTGAGGGATTTTCAGCATTGTATGGCAATCTCAGCGAAAAGAAGTCTTTGGATCTCACTGGC
TTCACATGGTATGACTATCACGCCTTGCTGGTAAATCCAAATTCTCTTTCTGCTTCTTCTAGTAACTTGATAAATGAGGATGAGAAAGAT
AATXCTAAAGCCAATGAGAATTTCCTTGGCTCTGCATTCACCCCTAGAGCGAGCACCGAAAAGTGCCCTTTCTTTGTTGAAGTTGXTAAC
TTGAGCTTTCCACTTCTTCCAGTTGCTGATTTTGTGGAGAAACATCTTTTTAGAAAGCTTCATGATCTTCTTGACCTCGGGTCTGTTTTA
AAAGTTAGCTTATTTTTTTTAGTTCTGGTGGTAATTTCAATTACCTTATTCGACTTGACTTTAAGTTTTCCTTATTATATATGGTCAAAA
TTCGATAAATGTAAAACTAAAAATCTTATCTCAATTGTTGAGATATACGTGGTAACCTTATCCGATTTGCTCAATCGAACAXTTGNAGGC
ACGATTTATGTGTATAAAAAAAAAAAAAAAAACTCGAAGGGGGGCCCGGTACCCAATTCGCCCTATAGGAGGCGAATTXACATTCACTGG
CCGGCGGTTTACAACGTCGTGACTGGGAAAACCCTTGCGTTACCAACCTTAATCCCTTTGCAGAAATTCCCCTTTTGGCCACTGGCGTAT
TACCGAAAAAGGCCCGCCCCGATGGCCCTTCCAAAAGXX
Edits in Original Sequence 
GTCGTTTCCAGGTATCACTCTCATCGCATTTGCAGCAATTACATATCTTCTCTCTTTTGCTCTCAAATTTGTTGCATTTAGGAATTTAAT
T
(5')GGTATCACTCTCATCGCATTTGCAGCAATTACATATCTTCTCTCTTTTGCTCTCAAATTTGTTGCATTTAGGAATTTAATTTACT
CCGCTGGCCCGAATCGATGTGTATACCGTGAAATTGAGGGATTTTCAGCATTGTATGGCAATCTCAGCGtAAAAGAAGTCTTTGGATCTC
ACTGGCTTCACATGGTATGACTATCACGCCTTGCTGGTAAtATCCAAATTCTCTTTCTGCTTCTTCTAGTAACTTGATAAATGtAGGATG
AGAAAGATAATXCTAAAGCCAATGAGAATTTCCTTGGCTCTGCATTCACCCCTAGAGCGAGCACCGAAAAGTGCCCTTTCTTTGTTGAAG
TTGXTAACTTGAGCTTTCCACTTCTTCCAGTTGCTGATTTTGTGGAGAAACATCTTTTTAGAAAGCTTCATGATCTTCTTGACCTCGGGT
CTGTTTTAAAAGTTAGCTTATTTTTTTTAGTTCTGcGTGGTAATTTCAATTACCTTATTCGACTTGACTTTAAGTTTTCCTTATTATATA
TGGTCAAAATTCGATAAATGTAAAACTAAAAATCTTATCTCAATTGTTGAGATATACGTGGTAACCTTATCCGATTTGCTCAATCGAACA
XTTGNAGGCACGATTTATGTGTATAAAAAAAAAAAAAAAAACTCGAAGGGGGGCCCGGTACCCAATTCGCCCTATAGGAGGCGAATTXAC
ATTCACTGGCCGGCGGTTTACAACGTCGTGACTGGGAAAACCCTTGCGTTACCAACCTTAATCCCTTTGCAGAAATTCCCCTTTTGGCCA
CTGGCGTATTACCGAAAAAGGCCCGCCCCGATGGCCCTTCCAAAAGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan