ESTScan Details for Unigene SGN-U335219

Score 
264
Direction 
Forward
Predicted Peptide Sequence 
MAPVSALAKYKLVFLGEQSVGKTSIITRFMYDKFDNTYQATIGIXLPIKDYVPGRSYRKIAVMGYCKQQRFRTLIPSYIRDTSAAVKDYD
VASRQSFLNTTKSIEDVPTEKGRDQIISPEGTKPDLVEKKQVSINERKAKTPQPKMMLIETTAKAAFKIKTLFKKKAPTFANNGKTNPPQ
NKKNKAACKKEAKQLKAHTNHKDQTGRRPGQPTR
Predicted Coding Sequence 
ATGGCTCCGGTTTCGGCTCTCGCAAAGTACAAGCTCGTTTTCTTAGGAGAACAATCTGTCGGCAAGACCAGTATTATCACGCGATTCATG
TATGATAAATTCGATAACACCTATCAAGCCACAATTGGTATTGXACTTCCTATCAAAGACTATGTACCTGGAAGATCGTACAGAAAGATC
GCAGTTATGGGATACTGCAAGCAACAGAGATTTAGGACTCTCATTCCCAGCTATATAAGGGACACCTCTGCTGCTGTCAAAGACTATGAC
GTTGCAAGCAGGCAGTCCTTTTTAAACACTACAAAAAGCATAGAGGACGTCCCAACTGAGAAGGGCAGAGACCAAATTATAAGCCCTGAA
GGAACAAAACCXGATCTTGTTGAGAAAAAGCAAGTTTCAATTAACGAAAGAAAAGCCAAAACTCCCCAACCAAAAATGATGTTAATCGAA
ACCACTGCAAAGGCAGCCTTCAAAATTAAAACCCTTTTTAAAAAAAAAGCACCCACCTTTGCCAACAATGGAAAAACTAACCCTCCGCAA
AACAAGAAAAACAAGGCGGCATGCAAAAAGGAAGCCAAGCAACTCAAAGCCCACACCAACCACAAGGACCAAACAGGAAGAAGGCCTGGA
CAACCTACACGGTAG
Edits in Original Sequence 
ACTCCGTCGGAAAATCCTGATCAGATCCGCCATCTTTTTTTTAAGTTACTGGATACAGGAACTCGTACCGAAAGATCCAATTAAATGGCT
CCGGTTTCGGCTCTCGCAAAGTACAAGCTCGTTTTCTTAGGAGAACAATCTGTCGGCAAGACCAGTATTATCACGCGATTCATGTATGAT
AAATTCGATAACACCTATCAAGCCACAATTGGTATTGACTTCCTATCAAAGACTATGTACCTGGAAGATCGTACAGAAAGA
(5')ATGGC
TCCGGTTTCGGCTCTCGCAAAGTACAAGCTCGTTTTCTTAGGAGAACAATCTGTCGGCAAGACCAGTATTATCACGCGATTCATGTATGA
TAAATTCGATAACACCTATCAAGCCACAATTGGTATTGXACTTCCTATCAAAGACTATGTACCTGGAAGATCGTACAGAAAGATCGCAGT
TATGGGATACTGCAAGtCAACAGAGATTTAGGACTCTCATTCCCAGCTATATAAGGGACACCTCTGCTGCTGTCAAAGACTATGACGTTG
CAAGCAGGCAGTCCTTTTTAAACACTACAAAAAGCATAGAGGACGTCCCAACTGAGAAGGGCAGAGACCAAATTATAAGCCCTGAAGGAA
CAAAACCXGATCTTGTTGAGAAAAAGCAAGTTTCAATTAACGAAAGAAAAGCCAAAACTCCCCAACCAAAAATGATGTTAATCGAAACCA
CTGCAAAGGCAGCCTTCAAAATTAAAACCtCTTTTTAAAAAAAAAGCACCCACCTTTGCCAACAATGGAAAAACTAACCCTCCGCAAAAC
AAGAAAAACAAGGCGGCATGCAAAAAGcGAAGCCAAGCAACTCAAAGCCCACACCAACCACAAGGACCAAACAGGAAGAAcGGCCTGGAC
AACCTACACGGTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan