ESTScan Details for Unigene SGN-U335231

Score 
384
Direction 
Forward
Predicted Peptide Sequence 
MGVQCQENILVTGGAGFIGTHTVVQLLNEGFEVTIIDNFHNSVKEAVDRIRELFGPLLSQNLEFHLGGIINKHDLEKLFSLKKNAAVVHF
AGLKAVGKKDCHPFLFFXEQSDWINNFVFSRGPXIIVKKRFFLYLPRVMDXPKKDPWLGGFLIERYGILLVQPELFLGKIAPGIPERWIQ
KGKFIPA
Predicted Coding Sequence 
ATGGGTGTTCAGTGTCAAGAAAATATTTTGGTGACTGGAGGAGCTGGTTTCATTGGAACACATACTGTGGTGCAGTTACTGAATGAAGGG
TTCGAAGTTACAATCATTGATAACTTTCATAATTCTGTGAAAGAAGCTGTTGATAGAATCAGAGAATTATTTGGTCCTCTACTTTCACAG
AATCTTGAATTCCATTTGGGTGGTATTATAAACAAACATGACTTGGAGAAGCTATTTTCTTTGAAAAAGAATGCTGCTGTGGTCCATTTT
GCTGGGCTTAAAGCTGTTGGAAAGAAAGATTGTCACCCCTTCCTTTTCTTTGAXGAACAATCTGATTGGATAAATAACTTTGTATTCAGT
CGTGGGCCCGXCATAATTGTTAAAAAAAGGTTTTTTCTTTATCTGCCACGGGTTATGGATAAXCCTAAAAAGGATCCCTGGTTGGGAGGA
TTTTTAATTGAAAGGTATGGAATCCTTTTGGTCCAACCAGAGCTTTTTCTTGGAAAAATTGCCCCGGGAATTCCAGAAAGGTGGATTCAG
AAAGGAAAATTCATACCTGCTTGA
Edits in Original Sequence 
TAAACTTTTTCCCTTTTTCTTCACGTATCTTCTACAACTAAAAAGAAAGAACCCCTTTTTTTCTGATTTTCCATAAAAATTGGTTCTTGA
AAGGATAAAGATTGAATCTTTGTTGTGTTTTATGAAATGGGTGTTCAGTGTCAAGAAAATATTTTGGTGACTGGAGGAGCTGGTTTCATT
GGAACACA
(5')ATGGGTGTTCAGTGTCAAGAAAATATTTTGGTGACTGGAGGAGCTGGTTTCATTGGAACACATACTGTGGTGCAGTTA
CTGAATGAAGGGTTCGAAGTTACAATCATTGATAACTTTCATAATTCTGTGAAAGAAGCTGTTGATAGAATCAGAGAATTATTTGGTCCT
CTACTTTCACAGAATCTTGAATTCCATTTGGGTGGTATTATAAACAAACATGACTTGGAGAAGCTATTTTCTTTGAAAAAGAATGCTGCT
GTGGTCCATTTTGCTGGGCTTAAAGCTGTTGGAAAGAAAGATTGTCACCCCTTCCTTTTCTTTGAXGAACAATCTGATTGGATAAATAAC
TTTGTATTCAGTCGTGGGCCCGXCATAATTGTTAAAAAAAGGTTTTTTCTTTATCTGCCACGGGTTATGGATAAXCCTAAAAAGGATCCC
TGGTTGGGAGGATTTTTAATTGAAAGGTATGGAATCCTTTTGGTCCAACCAGAGCTTTTTCTTGGAtAAAATTGCCCCGGGAATTCCAGA
AAGGTGGATTCAGAAAGGAAAATTCATACCTGCTTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan