ESTScan Details for Unigene SGN-U335278

Score 
184
Direction 
Reverse
Predicted Peptide Sequence 
MGGKIEHIDGKTEWKLRADSFCRMMQSPYNSRFWHEHIMNSLKDVXFLLPFLKTHLWQRTPSCLGKMEELNDFFYSSSSLQAHLFYLDFQ
RQSIYAESPSTLEEHSXVVATNFKPRAEFLQPGGSTSSRAAAAKIFPSLPRVRKPLPXX
Predicted Coding Sequence 
ATGGGTGGXAAGATTGAGCACATTGATGGGAAGACTGAGTGGAAGCTCCGCGCAGATAGCTTCTGCAGAATGATGCAGTCTCCTTACAAC
TCTAGATTCTGGCATGAGCACATCATGAACAGTTTAAAAGATGTTXATTTCCTGCTACCTTTCTTGAAGACTCACTTGTGGCAAAGAACT
CCTTCTTGTCTTGGTAAAATGGAGGAGCTGAATGACTTCTTCTACTCTTCTTCTTCCTTACAAGCTCATCTGTTTTACCTCGATTTCCAG
CGTCAATCCATTTATGCXGAGTCCCCATCCACCCTAGAGGAGCATAGCXTCGTGGTAGCAACTAATTTCAAGCCTCGTGCCGAATTCCTG
CAGCCCGGGGGATCCACTAGTTCTAGAGCGGCAGCCGCAAAAATATTCCCCTCTCTTCCCCGTGTCCGNAAGCCGCTCCCCTTNNNX
Edits in Original Sequence 
TTGACTCCCCATCGCGTGTAGTTGTGCAATCCCCTTGAGTTTGTAATTTTCTATTCCAGATGTTAACAAATTTCATTATAACCCTTGGTC
TAAATAGAGAAATATCAGGTCGTGTGAATTACTAAAATATTTTATTGAGATAATATCAGAAAGAGACCCAACCCTCCCAAGAAATTTTAT
AACATTACCTTTCAACAGAGAACACACCCTTTACCACATTATGGGTGGAAGATTGAGCACATTGATGGGAAGACTGAGTGGAAGCTCCGC
GCAGATAGCTTCTGCAGAATGATGCAGTCTCCTTACAACTCTAGATTCTGGCATGAGCACATCATGAACAGTTTAAAAGATGTTATTTCC
TGCTACCTTTCTTGAAGACTCACTTGTGGCAAAGAACTCCTTCTTGTCTTGGTAAAATGGAGGAGCTGAATGACTTCTTCTACTCTTCTT
CTT
(5')ATGGGTGGXAAGATTGAGCACATTGATGGGAAGACTGAGTGGAAGCTCCGCGCAGATAGCTTCTGCAGAATGATGCAGTCTCC
TTACAACTCTAGATTCTGGCATGAGCACATCATGAACAGTTTAAAAGATGTTXATTTCCTGCTACCTTTCTTGAAGACTCACTTGTGGCA
AAGAACTCCTTCTTGTCTTGGTAAAATGGAGGAGCTGAATGACTTCTTCTACTCTTCTTCTTCCTTACAAGCTCATCTGTTTTACCTCGA
TTTCCAGCGTCAATCCATTTATGCXGAGTCCCCATCCACCCTAGAGGAGCATAGCXTCGTGGTAGCAACTAATTTCAAGCCTCGTGCCGA
ATTCCTGCAGCCCGGGGGATCCACTAGTTCTAGAGCGGCAGCCGCAAAAATATTCCCCTCTCTTCCCCGTGTCCGNAAGCCGCTCCCCTT
NNNX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan