ESTScan Details for Unigene SGN-U335326

Score 
251
Direction 
Forward
Predicted Peptide Sequence 
PRGGGRSRTSGSPGLQEFGTREGGGDDEDEEIQVDPPKSNEVRIKMLFASLCHSDIIASNGFPIPLFPRVLGHEGVGYENLXLSVSFYAE
HVPVQGRAGHKGLLHEPYSAFQQETVYMALTCDGNNDLVNSCKLIHLANVDLFEFAAXIESVGENVTNLRKGDIVMPLYLGECRECPNCK
SGKSNLCHKYPLTLSGLMLDGTTRMSIHGAQVLYHSFSCATWSEYTVINVNYVIKVDPQKIPSHAACFXVDYSSYGAHGEKXMLKGIXCA
XTRSGAXGLERLKX
Predicted Coding Sequence 
XCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGGAAGGAGGGGGAGATGATGAAGAT
GAAGAGATACAAGTGGATCCACCTAAATCAAATGAAGTTCGAATTAAGATGCTCTTTGCCAGTTTGTGCCACTCTGACATTATCGCTTCC
AATGGCTTTCCCATTCCTTTATTTCCTCGAGTTCTTGGACATGAAGGAGTTGGGTACGAAAATCTTCXTCTCTCTGTTTCATTCTATGCA
GAACATGTACCGGTCCAGGGAAGAGCCGGACACAAGGGTCTACTACATGAACCTTACTCTGCATTTCAGCAAGAGACTGTTTACATGGCT
CTGACCTGTGATGGCAACAATGATCTAGTTAATTCTTGCAAATTGATTCATTTAGCCAATGTCGACTTATTTGAATTTGCAGCAXTGATA
GAAAGTGTGGGAGAAAATGTGACAAATCTAAGAAAAGGAGATATAGTGATGCCACTTTATTTGGGAGAATGCAGAGAATGCCCAAATTGC
AAGTCAGGGAAGTCCAATTTATGTCACAAATATCCCTTGACCCTTTCTGGTCTAATGTTGGATGGCACAACAAGAATGTCCATTCATGGA
GCACAAGTATTATACCATAGCTTTAGTTGTGCTACTTGGTCCGAATATACAGTTATTAATGTGAACTACGTAATCAAGGTTGATCCTCAG
AAGATCCCTTCACATGCTGCTTGCTTTNGTGTGGATTACAGCAGTTATGGAGCACATGGAGAGAAGXTCATGTTGAAAGGGATCNACTGT
GCTGXTACTAGGTCTGGTGCTGNTGGACTTGAGCGATTGAAGAAX
Edits in Original Sequence 
(5')XCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGGAAGGAGGGGGAGATGATGA
AGATcGAAGAGATACAAGTGGATCCACCTAAATCAAATGAAGTTCGAATTAAGATGCTCTTTGCCAGTTTGTGCCACTCTGACATTATCG
CTTCCAATGGCTTTCCCATTCCTTTATTTCCTCGAGTTCTTGGACATGAAGGAGTTGGGTACGAAAATCTTCXTCTCTCTGTTTCATTCT
ATGCAGAACATGTACCGGTCCAGGGAAGAGCCGGACACAAGGGTCTACTACATGtAACCTTACTCTGCATTTCAGCAAGAGACTGTTTAC
ATGGCTCTGACCTGTGATGGCAACAATGATCTAGTTAATTCTTGCAAATTGATTCATTTAGCCAATGTCGACTTATTTGAATTTGCAGCA
XTGATAGAAAGTGTGGGAGAAAATGTGACAAATCTAAGAAAAGGAGATATAGTGATGCCACTTTATTTGGGAGAATGCAGAGAATGCCCA
AATTGCAAGTCAGGGAAGTCCAATTTATGTCACAAATATCCCTTGACCCTTTCTGGTCTAATGTTGGATGGCACAACAAGAATGTCCATT
CATGGAGCACAAGTATTATACCATAGCTTTAGTTGTGCTACTTGGTCCGAATATACAGTTATTAATGTGAACTACGTAATCAAGGTTGAT
CCTCAGAAGATCCgCTTCACATGCTaGCTTGCTTTNGTGTGGATTACAGCAGTTATGGAGCACATGGAGAGAAGXTCATGTTGAAAGGGA
TCNACTGTGCTGXTACTAGGTCTGGTGCTGNTGGACTTGAGCGATTGAAGAAX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan