ESTScan Details for Unigene SGN-U335421

Score 
247
Direction 
Forward
Predicted Peptide Sequence 
LKPRTTGSPGLHEFDEDRAGTYLYLAHYGMQRQAGLQGMMRVSLPDGVLEPFSYDHDRSILLTDWYHKSTYEQATGLASLPFSWVGEPQV
KNTICTTYFNSFAYFDLTGIFNLFLFFQSILIHGRGRFNCSIPTIDPTLCNATNPQCTPYSMTVVPGKTYRLRIGSLTALSALSFEIEGL
NMTVVEADGHYVEPFVVKICSFILEKHSSALIKADQDPSRNX
Predicted Coding Sequence 
XGGTTGAAGCCTAGAACTACTGGATCCCCCGGGCTGCACGAATTCGACGAGGATAGGGCTGGAACATATTTGTACCTTGCTCATTATGGT
ATGCAAAGACAAGCAGGACTACAAGGAATGATGAGAGTATCATTACCTGATGGAGTTTTAGAGCCATTTTCATATGATCATGATAGGAGT
ATTCTTCTCACTGATTGGTACCACAAGAGCACTTATGAACAAGCAACTGGTCTTGCTTCATTGCCTTTTTCTTGGGTTGGAGAACCTCAG
GTAAAAAATACTATATGTACAACTTATTTCAATTCGTTTGCTTATTTTGACTTAACTGGAATTTTTAATTTGTTTCTTTTTTTTCAGTCA
ATCTTGATTCATGGAAGAGGAAGATTCAATTGTTCTATTCCGACCATAGATCCTACTCTTTGTAATGCTACAAATCCTCAATGTACACCT
TATTCAATGACTGTGGTTCCTGGCAAGACTTATAGGCTTAGAATTGGCAGCTTGACTGCTCTTTCAGCTCTAAGTTTTGAAATTGAAGGG
CTTAACATGACAGTTGTTGAGGCAGACGGTCACTATGTGGAGCCATTTGTGGTAAAAATCTGTTCATTTATTCTGGAGAAACACTCTTCA
GCCTTAATTAAAGCTGATCAAGACCCTTCCAGAAATTXX
Edits in Original Sequence 
(5')XGGTTGAAcGCCTAGAACTACTGGATCCCCCGGGCTGCACGAATTCGcACGAGGATAGGGCTGGAACATATTTGTACCTTGCTCAT
TATGGTATGCAAAGACAAGCAGGACTACAAGGAATGATGAGAGTATCATTACCTGATGGAGTTTTAGAGCCATTTTCATATGATCATGAT
AGGAGTATTCTTCTCACTGATTGGTACCACAAGAGCACTTATGAACAAGCAACTGGTCTTGCTTCATTGCCTTTTTCTTGGGTTGGAGAA
CCTCAGGTAAAAAATACTATATGTACAACTTATTTCAATTCGTTTGtCTTATTTTGACTTAACaTGGAATTTTTAATTTGTTTCTTTTTT
TTCAGTCAATCTTGATTCATGGAAGAGGAAGATTCAATTGTTCTATTCCGACCATAGATCCTACTCTTTGTAATGCTACAAATCCTCAAT
GTACACCTTATTCAATGACTGTGGTTCCTGGCAAGACTTATAGGCTTAGAATTGGCAGCTTGACTGCTCTTTCAGCTCTAAGTTTTGAAA
TTGAAGGGCTTAACATGACAGTTGTTGAGGCAGACGGTCACTATGTGGAGCCATTTGTGGTAAAAATCTGTTCATTTATTCTGGAGAAAC
ACTCTTCAGCCTTAATTAAAGCTGATCAAGACCCTTCCAGAAATTXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan