ESTScan Details for Unigene SGN-U335487

Score 
640
Direction 
Reverse
Predicted Peptide Sequence 
MPIEDVFFNSGXRGTVVTGRVEQGTIKVGEDVEILGLMQGTLKSTVTGVEMFKKILDHGQAGDNVGLLFRGLKRDDITRGMVIAKPGSVK
TCKKFEAEIYVLTKDEGGRHTAFFSNYMPQFYMRTADITGKVELPENVKMVMPGDNVTATFELMSPVPLDAGQRFALREGGRTVGAALFQ
K
Predicted Coding Sequence 
ATGCCCATAGAAGATGTATTTTTCAATTCAGGGGXACGTGGAACTGTTGTTACTGGGCGTGTTGAACAAGGAACCATAAAAGTGGGAGAA
GATGTGGAGATTTTAGGACTGATGCAGGGCACTTTAAAATCTACAGTTACTGGTGTTGAAATGTTCAAGAAGATCTTGGATCATGGACAA
GCTGGTGATAATGTTGGCCTTCTTTTTCGTGGCTTGAAACGAGATGACATTACGCGAGGAATGGTGATTGCAAAGCCTGGAAGTGTGAAA
ACATGCAAGAAATTTGAAGCAGAGATATATGTACTTACAAAGGATGAAGGTGGTCGTCACACTGCCTTCTTCTCAAATTATATGCCTCAA
TTTTACATGAGGACTGCTGACATCACTGGCAAAGTGGAGTTGCCTGAAAATGTCAAGATGGTTATGCCTGGGGATAATGTTACTGCTACT
TTTGAGCTGATGTCTCCGGTTCCCCTTGATGCAGGACAAAGATTTGCTTTGCGAGAAGGTGGTAGAACAGTTGGCGCGGCGTTGTTTCAA
AAGTAATAA
Edits in Original Sequence 
CCTAATGCCCATAGAAGATGTATTTTTCAATTCAGGGGACGTGGAACTGTTGTTACTGGGCGTGTTGAACAAGGAACCATAAAAGTGGGA
GAAGATGTGGAGATTTTAGGACTGATGCAGGGCACTTTAAAATCTACAGTTACTGGTGTTGAAATGTTCAAGAAGATCTTGGATCATGGA
CAAGCTGGTGATAATGTTGGCCTTCTTTTTCGTGGCTTGAAACGAGATGACATTACGCGAGGAATGGTGATTGCAAAGCCTGGAAGTGTG
AAAACATGCAAGAAATTTGAAGCAGAGATATATGTACTTACAAAGGATGAAGGTGGTCGTCACACTGCCTTCTTCTCAAATTATATGCCT
CAATTTTACATGAGGACTGCTGACATCACTGGCAAAGTGGAG
(5')ATGCCCATAGAAGATGTATTTTTCAATTCAGGGGXACGTGGAAC
TGTTGTTACTGGGCGTGTTGAACAAGGAACCATAAAAGTGGGAGAAGATGTGGAGATTTTAGGACTGATGCAGGGCACTTTAAAATCTAC
AGTTACTGGTGTTGAAATGTTCAAGAAGATCTTGGATCATGGACAAGCTGGTGATAATGTTGGCCTTCTTTTTCGTGGCTTGAAACGAGA
TGACATTACGCGAGGAATGGTGATTGCAAAGCCTGGAAGTGTGAAAACATGCAAGAAATTTGAAGCAGAGATATATGTACTTACAAAGGA
TGAAGGTGGTCGTCACACTGCCTTCTTCTCAAATTATATGCCTCAATTTTACATGAGGACTGCTGACATCACTGGCAAAGTGGAGTTGCC
TGAAAATGTCAAGATGGTTATGCCTGGGGATAATGTTACTGCTACTTTTGAGCTGATGTCTCCGGTTCCCCTTGATGCAGGACAAAGATT
TGCTTTGCGAGAAGGTGGTAGAACAGTTGGCGCgGGCGTTGTTTCAAAAGTAATAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan