ESTScan Details for Unigene SGN-U335491

Score 
1985
Direction 
Forward
Predicted Peptide Sequence 
PKSNFSLKGGSWGTEFVPIVFVSGPLFYRNFRSPDDKKPSISSISGNWMTSRKRINQVVQAAICXNQSLVGFILTLILLGFSMEVPVRRS
NYAILQQQPPYDEFNSDEKSKSRGDKGLYWDLIDRXKRYDAVSGLDCVTDESSEGSFAESSISGVSFGYMNAYSDVGGSLSKSWAQQTEE
SYQLQLTLALRISTEATCADDPNLLDYVPDESVSHASASSASVEAMSHRFWVNGSLSYFDKVPDGFYFIQGMDPYIWTVCSDLQESGRIP
SIESLMAVDPSVVPSVEVILIDRQSDPRLKELQNRIHSMYRSCNTTKEVVDQLAKLVCNHMGGAASVGEGDFIPIWKECCNDLKDCLGCF
VFPIGSLSVGLCRHRTLLFKVLADIIDLPCRIARGCKYCKESDAFSCLVRFGLDREYLVDLIRDPGCLYEPNSLLNGPSSISIPSPLRLP
RFGQVEPAMDFTSFAKQYFSDCLSLNLAFDDSSAGTAVDGDAGQTDRSSMDKSSAVPSSSNRDEVSRLPLPSINAWNKGCDKGSQLPAKY
HPPNMSISMSQEKDLIHLKNVPPIRYVDAHLIAISEARTDTINDQRYFEGVGRLAPAKPSRGLVLDVEDLDIPWNDLVLKERIGAGSFGT
VHRADWNGSDVAVKILMEQDFHAERYKEFLQEVAIMKRLRHPNIVLFMGAVTEPPNLSIVTEYLSRGSLYRLLHKPGAREVLDEKRRLCM
AYDVAKGMNYLHKRKPPVVHRDLKSPNLLVDTKYTVKVCDFGLSRLKANTFLSSKSAAGTPEWMAPEVLRDEPSNEKSDIYSFGVILWEL
ATLQQPWSNLNPPQVVAAVGFKGMRLEIPRDLNHPVTTIIEACWVNEPVETPLFFYYHGYVETAHITLATQPDCTDMQFLTVNAVVNACI
HTGETFALGIWLSDDVDASNMSFCICPGLILYIQEL
Predicted Coding Sequence 
XGGCCTAAAAGCAACTTCAGTCTGAAAGGGGGAAGTTGGGGAACTGAATTTGTCCCTATAGTATTTGTATCTGGTCCATTATTTTACCGG
AATTTCCGATCGCCGGACGACAAAAAGCCATCCATTTCCTCCATCTCCGGCAACTGGATGACTTCTAGAAAGAGAATAAACCAAGTAGTT
CAAGCTGCAATTTGTTAAAATCAGAGTTTGGTAGGGTTTATTTTGACTTTGATATTGTTAGGATTCTCCATGGAAGTACCTGTTAGACGT
TCGAATTATGCAATATTACAGCAGCAACCACCATACGATGAGTTTAATTCAGATGAGAAGAGCAAAAGTAGAGGTGATAAGGGATTATAT
TGGGACTTGATTGATCGCCXGAAAAGGTACGACGCCGTTTCAGGCCTCGATTGTGTTACCGACGAGTCAAGTGAAGGTAGCTTTGCTGAA
AGTTCCATTTCTGGAGTTTCATTTGGGTATATGAATGCTTATTCAGATGTTGGAGGTTCGTTGTCGAAAAGTTGGGCTCAACAGACGGAG
GAGAGCTACCAGCTGCAGTTAACGTTAGCTCTGAGGATCTCTACTGAAGCAACCTGCGCTGATGATCCCAATTTATTGGATTATGTGCCA
GATGAATCAGTATCCCATGCTTCAGCTTCATCTGCATCCGTGGAGGCAATGTCTCATAGATTCTGGGTAAATGGGAGCTTATCGTACTTT
GACAAAGTCCCCGATGGATTTTATTTCATTCAAGGGATGGATCCATATATTTGGACAGTCTGCTCAGATCTGCAAGAAAGTGGTCGTATC
CCATCAATTGAATCCTTGATGGCTGTTGATCCCTCTGTAGTACCATCAGTTGAAGTAATTTTGATTGATCGGCAAAGTGATCCCAGGTTA
AAGGAACTACAAAATCGAATCCATAGCATGTATCGTAGTTGCAACACCACAAAAGAAGTGGTTGATCAGCTTGCAAAGTTGGTTTGCAAT
CACATGGGAGGCGCAGCTTCTGTCGGAGAAGGTGACTTCATTCCTATCTGGAAGGAGTGCTGTAATGACCTGAAGGATTGTCTAGGATGT
TTTGTGTTTCCCATTGGTAGCCTTTCTGTTGGACTTTGTAGACATCGCACGTTGCTGTTTAAAGTTCTGGCGGACATCATTGATTTACCA
TGTCGAATTGCCAGAGGATGTAAATATTGTAAAGAATCCGATGCTTTCTCATGTCTAGTTCGGTTTGGCCTTGACAGGGAATACTTGGTT
GATTTGATTCGGGATCCAGGATGTTTATATGAACCAAATTCATTGCTCAATGGTCCATCTTCCATCTCAATTCCTTCACCATTGCGCCTT
CCGAGATTTGGACAAGTTGAACCTGCCATGGATTTCACGTCATTCGCTAAACAGTATTTTTCGGATTGTCTATCACTTAATCTGGCCTTT
GATGATTCTTCAGCAGGAACTGCAGTTGATGGGGATGCTGGACAAACGGACAGAAGTTCCATGGATAAAAGCAGTGCAGTTCCTAGTTCA
AGCAATCGTGATGAAGTTTCACGGCTACCTTTGCCTTCAATAAATGCATGGAACAAGGGATGTGATAAAGGCTCTCAACTTCCTGCAAAA
TATCATCCTCCAAATATGTCGATCTCAATGAGCCAGGAAAAGGATTTGATTCATTTGAAGAATGTCCCTCCAATTAGGTATGTAGATGCT
CACCTGATTGCAATATCTGAGGCAAGGACAGATACCATTAATGACCAGAGGTACTTTGAGGGAGTAGGGAGACTTGCTCCTGCTAAACCA
AGCCGAGGACTTGTTCTTGATGTAGAAGATCTGGATATTCCCTGGAATGATCTGGTTCTGAAGGAAAGAATTGGGGCAGGGTCTTTTGGG
ACTGTTCACCGTGCTGACTGGAATGGCTCTGATGTTGCTGTGAAAATTCTCATGGAACAGGATTTTCATGCTGAGCGATACAAGGAATTT
TTGCAAGAGGTTGCAATTATGAAGCGGTTGCGACATCCAAATATAGTGCTTTTCATGGGTGCTGTTACTGAGCCACCAAACTTGTCGATA
GTTACAGAATATTTATCAAGAGGTAGCCTATATAGGCTTCTTCATAAACCTGGTGCGAGAGAGGTATTGGATGAAAAACGTCGGTTGTGT
ATGGCTTACGATGTGGCAAAGGGGATGAATTATCTTCATAAACGCAAACCACCTGTTGTTCACAGAGATTTAAAATCTCCAAATCTTTTA
GTGGATACAAAATATACAGTGAAGGTCTGTGATTTTGGTCTTTCTCGATTAAAAGCTAATACATTTTTGTCATCAAAGTCAGCTGCCGGG
ACTCCAGAATGGATGGCACCTGAAGTTCTCCGTGATGAGCCGTCAAATGAGAAATCTGATATATACAGCTTTGGTGTCATCTTGTGGGAG
CTGGCAACGTTGCAACAACCTTGGAGTAATTTGAACCCACCACAGGTAGTAGCAGCTGTTGGCTTTAAGGGTATGAGGCTTGAAATTCCA
CGTGACTTGAATCATCCGGTGACAACTATTATTGAAGCTTGCTGGGTGAATGAGCCXGTGGAAACGCCCCTCTTTTTCTACTATCATGGA
TATGTTGAAACCGCTCATATAACTCTTGCAACACAACCAGATTGTACAGACATGCAGTTCCTCACXGTAAATGCTGTAGTAAATGCTTGT
ATTCATACAGGAGAAACATTTGCACTTGGTATTTGGCTTAGTGATGATGTTGATGCTAGCAATATGAGTTTCTGCATCTGTCCAGGATTG
ATTTTGTATATACAAGAACTATAA
Edits in Original Sequence 
(5')XGGCCTAAAAGCAACTTCAGTCTGaAAAGGGGGAAGTTGGGGAACTGAATTTGTCCCTATAGTATTTGTATCTGGTCCATTATTTT
ACCGGAATaTTCCGATCGCCGGACGACAAAAAGCCATCCATTTCCTCCATCTCCGGCAACTGGATGACTTCTAGAAAGAGAATAAACCAA
GTAGTTCAAGCTGCAATTTGTTAAAATCAGAGTTTGGTAGGGTTTATTTTGACTTTGATATTGTTAGGATTCTCCATGGAAGTACCTGTT
AGACGTTCGAATTATGCAATATTACAGCAGCAACCACCATACGATGAGTTTAATTCAGATGAGAAGAGCAAAAGTAGAGGTGATAAGGGA
TTATATTGGGACTTGATTGATCGCCXGAAAAGGTACGACGCCGTTTCAGGCCTCGATTGTGTTACCGACGcAGTCAAGTGAAGGTAGCTT
TGCTGAAAGTTCCATTTCTGGAGTTTCATTTGGGTATATGAATGCTTATTCAGATGTTGGAGGTTCGTTGTCGAAAAGTTGGGCTCAACA
GACGGAGGAGAGCTACCAGCTGCAGTTAACGTTAGCTCTGAGGATCTCTACTGAAGCAACCTGCGCTGATGATCCCAATTTATTGGATTA
TGTGCCAGATGAATCAGTATCCCATGCTTCAGCTTCATCTGCATCCGTGGAGGCAATGTCTCATAGATTCTGGGTAAATGGGAGCTTATC
GTACTTTGACAAAGTCCCCGATGGATTTTATTTCATTCAAGGGATGGATCCATATATTTGGACAGTCTGCTCAGATCTGCAAGAAAGTGG
TCGTATCCCATCAATTGAATCCTTGATGGCTGTTGATCCCTCTGTAGTACCATCAGTTGAAGTAATTTTGATTGATCGGCAAAGTGATCC
CAGGTTAAAGGAACTACAAAATCGAATCCATAGCATGTATCGTAGTTGCAACACCACAAAAGAAGTGGTTGATCAGCTTGCAAAGTTGGT
TTGCAATCACATGGGAGGCGCAGCTTCTGTCGGAGAAGGTGACTTCATTCCTATCTGGAAGGAGTGCTGTAATGACCTGAAGGATTGTCT
AGGATGTTTTGTGTTTCCCATTGGTAGCCTTTCTGTTGGACTTTGTAGACATCGCACGTTGCTGTTTAAAGTTCTGGCGGACATCATTGA
TTTACCATGTCGAATTGCCAGAGGATGTAAATATTGTAAAGAATCCGATGCTTTCTCATGTCTAGTTCGGTTTGGCCTTGACAGGGAATA
CTTGGTTGATTTGATTCGGGATCCAGGATGTTTATATGAACCAAATTCATTGCTCAATGGTCCATCTTCCATCTCAATTCCTTCACCATT
GCGCCTTCCGAGATTTGGACAAGTTGAACCTGCCATGGATTTCACGTCATTCGCTAAACAGTATTTTTCGGATTGTCTATCACTTAATCT
GGCCTTTGATGATTCTTCAGCAGGAACTGCAGTTGATGGGGATGCTGGACAAACGGACAGAAGTTCCATGGATAAAAGCAGTGCAGTTCC
TAGTTCAAGCAATCGTGATGAAGTTTCACGGCTACCTTTGCCTTCAATAAATGCATGGAACAAGGGATGTGATAAAGGCTCTCAACTTCC
TGCAAAATATCATCCTCCAAATATGTCGATCTCAATGAGCCAGGAAAAGGATTTGATTCATTTGAAGAATGTCCCTCCAATTAGGTATGT
AGATGCTCACCTGATTGCAATATCTGAGGCAAGGACAGATACCATTAATGACCAGAGGTACTTTGAGGGAGTAGGGAGACTTGCTCCTGC
TAAACCAAGCCGAGGACTTGTTCTTGATGTAGAAGATCTGGATATTCCCTGGAATGATCTGGTTCTGAAGGAAAGAATTGGGGCAGGGTC
TTTTGGGACTGTTCACCGTGCTGACTGGAATGGCTCTGATGTTGCTGTGAAAATTCTCATGGAACAGGATTTTCATGCTGAGCGATACAA
GGAATTTTTGCAAGAGGTTGCAATTATGAAGCGGTTGCGACATCCAAATATAGTGCTTTTCATGGGTGCTGTTACTGAGCCACCAAACTT
GTCGATAGTTACAGAATATTTATCAAGAGGTAGCCTATATAGGCTTCTTCATAAACCTGGTGCGAGAGAGGTATTGGATGAAAAACGTCG
GTTGTGTATGGCTTACGATGTGGCAAAGGGGATGAATTATCTTCATAAACGCAAACCACCTGTTGTTCACAGAGATTTAAAATCTCCAAA
TCTTTTAGTGGATACAAAATATACAGTGAAGGTCTGTGATTTTGGTCTTTCTCGATTAAAAGCTAATACATTTTTGTCATCAAAGTCAGC
TGCCGGGACTCCAGAATGGATGGCACCTGAAGTTCTCCGTGATGAGCCGTCAAATGAGAAATCTGATATATACAGCTTTGGTGTCATCTT
GTGGGAGCTGGCAACGTTGCAACAACCTTGGAGTAATTTGAACCCACCACAGGTAGTAGCAGCTGTTGGCTTTAAGGGTATGAGGCTTGA
AATTCCACGTGACTTGAATCATCCGGTGACAACTATTATTGAAGCTTGCTGGGTGAATGAGCCXGTGGAAACGCCCCTCTTTTTCTACTA
TCATGGATATGTTGAAACCGCTCATATAACTCTTGCAACACAACCAGATTGTACAGACATGCAGTTCCTCACXGTAAATGCTGTAGTAAA
TGCTTGTATTCATACAGGAGAAACATTTGCACTTGGTATTTGGCTTAGTGATGATGTTGATGCTAGCAATATGAGTTTCTGCATCTGTCC
AGGATTGATTTTGTATATACAAGAACTATAA(3')CAGGACGTTGTAATATATACGTAAATAATATTCTCTTCGGCGGCTAAATAAGCTA
GCAATCTTTTCTCAATGATGATCACAATTAACAATTTTTGGTGGCCCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan