ESTScan Details for Unigene SGN-U335494

Score 
1008
Direction 
Forward
Predicted Peptide Sequence 
ILGKIKIGINGFGRIGRLVARVALQRDDVELVAVNDPFITVEYMTYMFKYDSVHGQWKNNELKVKDEKTLLFGEKPVTVFGIVESTGVFT
DKDKAAAHLKGGAKKVVISAPSKDAPMFVVGVNEKEYKPDLNIVSNASCTTNCLAPLAKVIHDRFGIVEGLMTTVHSITATHKTVDGPSP
KDWRGGTAASFNIIPSTTGACKAVGKVLPSLNGKXTGMSFRVPTVNVSVVDLLXEVGKKTHLDELKAAFKEDPEGN
Predicted Coding Sequence 
ATCCTGGGCAAGATTAAGATCGGAATCAATGGTTTTGGAAGAATTGGCCGATTGGTGGCCAGGGTGGCTCTACAAAGAGATGATGTTGAG
CTCGTTGCTGTTAACGATCCCTTCATCACCGTGGAATACATGACATACATGTTTAAGTATGACAGTGTTCACGGTCAATGGAAGAACAAT
GAGCTCAAGGTTAAGGATGAGAAGACTCTTCTCTTTGGTGAGAAGCCTGTTACTGTATTTGGCATCGTGGAGTCAACTGGAGTCTTCACT
GATAAAGACAAGGCTGCTGCCCACTTGAAGGGTGGTGCTAAGAAAGTAGTTATTTCTGCTCCTAGCAAGGATGCACCTATGTTTGTTGTT
GGTGTCAATGAAAAGGAATACAAGCCAGACCTCAACATCGTTTCTAATGCTAGCTGTACTACTAACTGCCTTGCACCTCTGGCAAAGGTT
ATTCATGACAGGTTTGGAATCGTTGAGGGTCTTATGACTACAGTTCACTCCATAACTGCCACCCACAAAACTGTTGATGGACCATCACCT
AAGGACTGGAGGGGAGGAACAGCTGCATCATTCAACATTATCCCCAGCACCACTGGAGCTTGCAAGGCTGTTGGAAAGGTGCTACCATCA
TTGAATGGAAAGTTNACAGGAATGTCTTTCCGAGTTCCAACAGTCAATGTCTCTGTGGTTGATCTCCTTGXTGAGGTTGGAAAAAAAACC
CACCTAGATGAACTCAAGGCTGCTTTTAAGGAAGATCCTGAAGGAAATTAA
Edits in Original Sequence 
ATTTTCCTTCTCAGTTCACAAAAAAAAATCCTGGGCAAGA(5')ATCCTGGGCAAGATTAAGATCGGAATCAATGGTTTTGGAAGAATTG
GCCGATTGGTGGCCAGGGTGGCTCTACAAAGAGATGATGTTGAGCTCGTTGCTGTTAACGATCCCTTCATCACCGTGGAATACATGACAT
ACATGTTTAAGTATGACAGTGTTCACGGTCAATGGAAGAACAATGAGCTCAAGGTTAAGGATGAGAAGACTCTTCTCTTTGGTGAGAAGC
CTGTTACTGTATTTGGCATCGTGGAGTCAACTGGAGTCTTCACTGATAAAGACAAGGCTGCTGCCCACTTGAAGGGTGGTGCTAAGAAAG
TAGTTATTTCTGCTCCTAGCAAGGATGCACCTATGTTTGTTGTTGGTGTCAATGAAAAGGAATACAAGCCAGACCTCAACATCGTTTCTA
ATGCTAGCTGTACTACTAACTGCCTTGCACCTCTGGCAAAGGTTATTCATGACAGGTTTGGAATCGTTGAGGGTCTTATGACTACAGTTC
ACTCCATAACTGCCACCCACAAAACTGTTGATGGACCATCACCTAAGGACTGGAGGGGAGGAACAGCTGCATCATTCAACATTATCCCCA
GCACCACTGGAGCTTGCAAGGCTGTTGGAAAGGTGCTACCATCATTGAATGGAAAGTTNACAGGAATGTCTTTCCGAGTTCCAACAGTCA
ATGTCTCTGTGGTTGATCTCCTTGXTGAGGTTGGAAAAAAAACCCACCTAGATGAACTCAAGGCTGCTTTTAAGGAAGATCCTGAAGGAA
ATTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan