ESTScan Details for Unigene SGN-U335539

Score 
143
Direction 
Forward
Predicted Peptide Sequence 
GGGRSRTSGSPGLQELSTRINQCGXGVGGLKDSGGGVMDPAAAMGYIEKLLKVRLSKPGKLVQLSESEIKQLCVSSRDXLPLTAKSTELE
TTINMGWDFLRPVGDLLRLCEYGGSPPEASYLFWGDYVDRGEAELGNNMPLAAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRFNV
KLWKSFTDCFNCLPVTALIDEKILCMHGGLSPDLSSLDQIPNLPRSTGIPETGVGFAIYLGADPPEKI
Predicted Coding Sequence 
GGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTGAGTACGAGGATTAATCAGTGTGGAXTCGGTGTTGGGGGATTG
AAGGACAGCGGCGGGGGAGTCATGGACCCTGCCGCTGCCATGGGATATATTGAGAAGCTATTAAAAGTTCGATTATCGAAGCCTGGCAAG
TTGGTGCAGCTTTCCGAGTCTGAAATCAAGCAACTATGTGTTTCCTCTAGAGATXATCTTCCCTTAACAGCCAAATCTACTGAACTTGAG
ACAACCATCAATATGGGCTGGGACTTTCTTAGGCCTGTGGGTGATCTGTTGAGGCTTTGTGAATATGGTGGCTCTCCTCCGGAGGCTAGC
TACTTATTCTGGGGTGATTATGTAGATCGTGGXGAAGCAGAGCTTGGAAACAATATGCCTCTTGCTGCCTATAAGATCAAGTATCCTGAG
AACTTTTTCTTGCTTAGAGGAAACCATGAATGTGCTTCTATAAATAGGATATATGGATTCTATGATGAGTGTAAGCGTCGGTTCAATGTG
AAACTATGGAAGTCCTTTACAGACTGTTTTAATTGTCTTCCTGTAACAGCACTTATCGATGAGAAGATATTATGCATGCATGGGGGTCTG
TCCCCTGATCTTTCTAGTTTGGATCAGATTCCGAACTTACCACGTTCAACTGGCATTCCCGAAACTGGXGTTGGTTTTGCGATTTACCTT
GGGGCAGATCCXCCGGAAAAGATTTAA
Edits in Original Sequence 
(5')GGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTGAGTACGAGGATTAATCAGTGTGGAXTCGGTGTTGGGGG
ATTGAAGGACAGCGGCGGGGGAGTCATGGACCCTGCCGCTGtCCATGGGATATATTGAGAAGCTATTAAAAGTTCGATTATCGAAGCCTG
GCAAGTTGGTGCAGCTTTCCGAGTCTGAAATCAAGCAACTATGTGTTTCCTCTAGAGATXATCTTCCCTTAACAGCCAAATCTACtTGAA
CTTGAGACAACCATCAATATGGGCTGGGACTTTCTTAGGCCTGTGGGTGATCTGTTGAGGCTTTGTGAATATGGTGGCTCTCCTCCGGAG
GCTAGCTACTTATTCTGGGGTGATTATGTAGATCGTGGXGAAGCAGAGCTTGGAAACAATATGCCTCTTGCtTGCCTATAAGATCAAGTA
TCCTGAGAACTTTTTCTTGCTTAGAGGAAACCATGAATGTGCTTCTATAAATAGGATATATGGATTCTATGATGAGTGTAAGCGTCGGTT
CAATGTGAAACTATGGAAGTCCTTTACAGACTGTTTTAATTGTCTTCCTGTAACAGCACTTATCGATGAGAAGATATTATGCATGCATGG
GGGTCTGTCCCCTGATCTTTCTAGTTTGGATCAGATTCCGAACTTACCACGTTCAACTGGCATTCCCGAAACTGGXGTTGGTTTTGCGAT
TTACCTTGGGGCAGATCCXCCGGAAAAGATTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan