ESTScan Details for Unigene SGN-U335679

Score 
-104
Direction 
Forward
Predicted Peptide Sequence 
MRGWENPGVSPFYSLGKNPPFPNWAKNKKGPTESPSPKVAHLNGKWAIVNGKFLVKFPEIFGKPTPFFPKGPKPEKPFLIPKNNQNRFKG
FPILKKKPLIKNGGPPGPRGKKPPLGGMAPLPETSPPINFFGGRGGPKTHXIGNPKGGPPILKFTGEKPAETGEKRRGKNPKG
Predicted Coding Sequence 
ATGCGGGGCTGGGAAAACCCCGGCGTTTCCCCATTTTATTCCCTTGGAAAAAATCCCCCTTTTCCCAACTGGGCTAAAAACAAAAAAGGC
CCAACCGAATCCCCCTCTCCAAAAGTGGCCCACCTTAATGGGAAATGGGCAATTGTAAACGGTAAATTTTTGGTAAAATTCCCCGAAATT
TTTGGTAAACCCACTCCCTTTTTTCCAAAAGGCCCAAAACCGGAAAAACCCTTTTTAATTCCAAAAAATAACCAAAATCGGTTTAAGGGT
TTTCCCATTTTGAAAAAAAAACCCCTAATTAAAAACGGGGGGCCCCCAGGCCCAAGGGGGAAAAAACCGCCTTTAGGGGGAATGGCCCCC
CTTCCGGAAACCTCCCCCCCAATTAATTTTTTTGGGGGGCGGGGGGGCCCCAAAACCCATAXAATTGGGAACCCTAAAGGGGGCCCCCCG
ATTTTAAAATTTACCGGGGAGAAACCGGCAGAAACTGGCGAAAAAAGGAGGGGGAAAAATCCAAAGGGX
Edits in Original Sequence 
TGCTATTGTAGCTGGTTGTAATTGTAACCTCATGTTCAGCTTATTCTCTGTTTTACTTGCTATGTAAATATGCGTGTGCATTTTTCAATA
TATTTCAACAACTTCCAAGGACGAACAGTAGTAATTCACTTTTTTAGAGTAATAAAAGGTGACTAATGTTCATTTGGTTCCG
(5')ATGC
GGGGCTGGGAAAACCCCGGCGTTTCCCCATTTTATTCCCTTGGAAAAAATCCCCCTTTTCCCAACTGGGCTAAAAACAAAAAAGGCCCAA
CCGAATCCCCCTCTCCAAAAGTGGCCCACCTTAATGGGAAATGGGCAATTGTAAACGGTAAATTTTTGGTAAAATTCCCCGtAAATTTTT
GGTAAACCCACTCCCTTTTTTaCCAAAAGGCCCAAAACCGGAAAAACCCTTTTTAATTCCaAAAAAATAACCAAAATCGGTTTAAGGGTT
TTCCCATTTTGAAAAAAAAACCCCTAATTAAAAACGGGGGGCCCCCAGGCCCAAGGGGGAAAAAACCGCCTTTAGGGGGAATGGCCCCCC
TTCCGGAAACCTCCCCCCCAATTAATTTTTTTGGGGGGCGGGGGGGCCCCAAAACCCATAXAATTGGGAACCCTAAAGGGGGCCCCCCGA
TTTTAAAATTTACCGGGGAGAAACCGGCAGAAACTGGCGAAAAAAGGAGGGGGAAAAATCCAAAGGGX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan