ESTScan Details for Unigene SGN-U335692

Score 
130
Direction 
Reverse
Predicted Peptide Sequence 
MSNREVNFNHHPLETRTRRIIISFIETNFAGSSGAEARLFDEYDDNXLEEIQGNFLLPQIMWGAGRSDISFTIVFFMILDIFPPEVSFPI
AAAFPSHEEPCRVKHQMRIFSYXEVVEQYEVXVSKWIRSVKVRPSAFDPRVALFVVCSSCPNVVHPDTSXDMDFCIDSGAEFLQPGGSTS
SRAAATAVELQLLSL
Predicted Coding Sequence 
ATGTCAAATAGAGAAGTTAACTTTAATCATCATCCATTAGAAACAAGAACAAGGAGAATAATTATTAGTTTTATTGAAACTAATTTTGCA
GGTTCCTCTGGTGCAGAAGCAAGGCTTTTCGACGAATACGACGATAATXCACTAGAAGAAATTCAGGGTAACTTTTTGTTGCCACAAATC
ATGTGGGGTGCTGGAAGGTCAGACATTTCATTCACTATTGTGTTTTTCATGATACTAGATATATTTCCTCCAGAAGTTTCTTTTCCTATA
GCAGCAGCTTTTCCTTCTCATGAAGAACCTTGCAGAGTCAAGCATCAAATGCGTATTTTTAGCTATGAXGAGGTAGTAGAGCAGTATGAA
GTTAXGGTATCCAAATGGATAAGGTCAGTCAAAGTGAGACCATCAGCATTCGATCCTCGAGTTGCXCTTTTCGTAGTTTGTAGCAGTTGT
CCCAATGTTGTGCACCCCGACACCTCTGAXGACATGGATTTCTGCATAGATTCTGGTGCCGAATTCCTGCAGCCCGGGGGATCCACTAGT
TCTAGAGCGGCCGCCACCGCGGTGGAGCTCCAGCTTTTGTCCCTTTAGTGA
Edits in Original Sequence 
TCACAAAAAAATCATAACAATAATGTGTAGGGTAATCAATTTCAAGTACTCCATTATACAACTTAAAAAGAGGGAAAAATAGGCATATAA
GTCACCCTCTAGTAAATATGTCAAAGTAGAGAAGTTAACTTTAATCATCATCCATTAGAAACAAGAACAAGGATGAATAATTATTAGTTT
TATTGAAACTAATTTTGCAGGTTCCTCTGGTGCAGAAGCAAGGCTTTTCGACGAATACGACGATAATCACTAGAAGAAATTCAGGGTAAC
TTTTT
(5')ATGTCAAAgTAGAGAAGTTAACTTTAATCATCATCCATTAGAAACAAGAACAAGGAtGAATAATTATTAGTTTTATTGAAA
CTAATTTTGCAGGTTCCTCTGGTGCAGAAGCAAGGCTTTTCGACGAATACGACGATAATXCACTAGAAGAAATTCAGGGTAACTTTTTGT
TGtCCACAAATCATGTGGGGTGCTGGAAGGTCAGACATTTCATTCACTATTGTGTTTTTCATGATACTAGATATATTgTCCTCCAGAAGT
TTCTTTTCCTATAGCAGCAGCTTTTCCTTCTCATGAAGAACCTTaGCAGAGTCAAGCATCAAATGCGTATTTTTAGCTATGAXGAGGTAG
TAGAGCAGTATGAAGTTAXGGTATCCAAATGGATAAGGTCAGTCAAAGTGAGACCATCAGCATTCGATCCTCGAGTTGCXCTTTTCGTAG
TTTGTAGCAGTTGTCCCAATGTTGTGCACCCCGACACCTCTGAXGACATGGATTTCTGCATAGATTCTGGTGCCGAATTCCTGCAGCCCG
GGGGATCCACTAGTTCTAGAGCGGCCGCCACCGCGGTGGAGCTCCAGCTTTTGTCCCTTTAGTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan