Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U335708

Score 
-28
Direction 
Reverse
Predicted Peptide Sequence 
GDVLQANXVGNARVFPVTTCKPRPVNCNTTPYRANWVPAPPRSVTGNXDGAKTGKVVGTHGYMSPEYAVDGMFSVKSDVFSFGVLVLEIV
SGKKNRGFSHQDHNLNLFGHAWKLYKEDRSLELADEQLADSCKTSQILRSIQVGLLCVQQHPNDRPSMFSVVQMLANESLLPKAKEPGFF
TERNVYDEGKSGSQITSSKNEVPIPLLDPR
Predicted Coding Sequence 
GGGGATGTGCTGCAGGCGAATAXAGTTGGTAACGCCAGGGTTTTCCCAGTCACGACGTGTAAACCGAGGCCAGTGAATTGTAATACGACT
CCCTATAGGGCGAATTGGGTACCGGCCCCCCCTCGAAGTGTTACAGGAAATGAXGATGGGGCAAAAACAGGCAAAGTTGTTGGGACACAT
GGTTACATGTCCCCTGAATATGCAGTAGATGGGATGTTTTCGGTAAAATCAGATGTGTTTAGCTTTGGCGTATTGGTGTTAGAGATTGTG
AGTGGCAAGAAAAATAGAGGATTTTCCCATCAAGACCACAACCTTAACCTTTTCGGTCACGCATGGAAGCTTTACAAAGAGGATAGGTCG
TTGGAACTAGCTGATGAGCAGCTAGCTGACTCGTGCAAAACTTCTCAAATTTTAAGGTCCATTCAAGTGGGTTTACTATGCGTGCAACAA
CATCCGAATGATAGACCAAGCATGTTTTCTGTGGTTCAGATGTTGGCTAATGAGAGTTTACTGCCAAAAGCAAAAGAGCCAGGATTTTTC
ACAGAACGAAATGTATATGACGAAGGAAAATCCGGATCGCAGATAACAAGTTCAAAAAATGAAGTCCCAATCCCATTATTAGATCCTCGT
TAG
Edits in Original Sequence 
(5')GGGGATGTGCTGCAGGCGAATAXAGTTGGTAACGCCAGGGTTTTCCCAGTCACGACGTGTAAACCGAcGGCCAGTGAATTGTAATA
CGACTCCCTATAGGGCGAATTGGGTACCgGGCCCCCCCTCGAAGTGTTACAGGAAATGAXGATGGGGCAAAAACAGGCAAAGTTGTTGGG
ACACATGGTTACATGTCCCCTGAATATGCAGTAGATGGGATGTTTTCGGTAAAATCAGATGTGTTTAGCTTTGGCGTATTGGTGTTAGAG
ATTGTGAGTGGCAAGAAAAATAGAGGATTTTCCCATCAAGACCACAACCTTAACCTTTTCGGTCACGCATGGAAGCTTTACAAAGAGGAT
AGGTCGTTGGAACTAGCTGATGAGCAGCTAGCTGACTCGTGCAAAACTTCTCAAATTTTAAGGTCCATTCAAGTGGGTTTACTATGCGTG
CAACAACATCCGAATGATAGACCAAGCATGTTTTCTGTGGTTCAGATGTTGGCTAATGAGAGTTTACTGCCAAAAGCAAAAGAGCCAGGA
TTTTTCACAGAACGAAATGTATATGACGAAGGAAAATCCGGATCGCAGATAACAAGTTCAAAAAATGAAGTCCCAATCCCATTATTAGAT
CCTCGTTAG(3')TTAATGGTTGTATCTTATCATCTATTTGTGTTGTTCTTTG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan