Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U335711

Score 
479
Direction 
Forward
Predicted Peptide Sequence 
MAQGLIKLAQEDPSFHFSRDEEINQTVIEGMGELHLEIIVDRLKREFKVEANVGAPQVNYRESISRNSEVKYVHKKQSGGSGQFADITVR
FEPMEAGGGYEFKSEIKGGAVPKEYIPGVMKGLEECMSNGVLAGFPVVDVRAVLVDGSYHDVDSSVLAFQLAARGAFREGMRKAGPQLQY
LARNDKGAASYVMQLAKFDVVPQHIXKPACXKGGSSCCLVSHLPDFGSTNLKIGIFLDEDVKAWTTFFLYVPAWNTDGEXADIXVMRLSF
FKRLCMLVNYKLKLQETEETQKGNGILAF
Predicted Coding Sequence 
ATGGCGCAAGGTTTAATAAAACTGGCACAAGAGGATCCGTCTTTCCATTTTTCACGTGATGAGGAGATTAACCAGACAGTTATTGAGGGA
ATGGGAGAATTACATCTTGAGATCATTGTAGATCGACTGAAAAGGGAATTTAAGGTGGAAGCTAATGTCGGAGCTCCACAAGTCAACTAC
CGCGAGAGCATTTCCAGGAACTCAGAAGTAAAATACGTGCATAAGAAGCAGTCTGGTGGTTCAGGACAGTTTGCTGATATCACAGTAAGG
TTTGAACCCATGGAAGCAGGTGGTGGATATGAATTCAAGAGTGAAATCAAGGGAGGTGCAGTGCCAAAAGAATATATCCCTGGTGTTATG
AAGGGATTAGAAGAATGCATGAGTAACGGAGTACTGGCAGGCTTTCCAGTTGTTGATGTTCGTGCTGTGCTAGTAGATGGATCTTACCAT
GATGTGGATTCAAGTGTTTTGGCATTCCAGCTGGCTGCTCGGGGAGCTTTTAGGGAAGGGATGAGAAAAGCTGGTCCACAATTGCAGTAC
CTTGCGAGGAATGACAAAGGGGCTGCATCGTATGTTATGCAGTTAGCCAAATTTGACGTTGTCCCTCAACACATTXCAAAACCAGCTTGC
CNAAAAGGAGGAAGCAGCTGCTGCTTAGTCAGTCATCTTCCAGATTTTGGATCCACAAACTTGAAAATAGGTATTTTTCTCGACGAAGAT
GTTAAGGCTTGGACAACATTCTTTTTGTACGTACCAGCATGGAACACCGATGGAGAAXTAGCTGATATTXTAGTCATGCGTCTGAGTTTT
TTCAAACGTTTGTGTATGTTGGTGAATTATAAGCTGAAACTCCAAGAGACGGAAGAAACCCAGAAGGGAAATGGTATACTTGCATTTTAA
Edits in Original Sequence 
GGTTGCAATTGAACCTAAGACCAAGGCAGACATTGATAAGATGGCGCAAGGTTTAATAAAACTGGCACAAGAGGATCCGTCTTTCCATTT
TTCACGTGATG
(5')ATGGCGCAAGGTTTAATAAAACTGGCACAAGAGGATCCGTCTTTCCATTTTTCACGTGATGAGGAGATTAACCAG
ACAGTTATTGAGGGAATGGGAGAATTACATCTTGAGATCATTGTAGATCGACTGAAAAGGGAATTTAAGGTGGAAGCTAATGTCGGAGCT
CCACAAGTCAACTACCGCGAGAGCATTTCCAGGAACTCAGAAGTAAAATACGTGCATAAGAAGCAGTCTGGTGGTTCAGGACAGTTTGCT
GATATCACAGTAAGGTTTGAACCCATGGAAGCAGGTGGTGGATATGAATTCAAGAGTGAAATCAAGGGAGGTGCAGTGCCAAAAGAATAT
ATCCCTGGTGTTATGAAGGGATTAGAAGAATGCATGAGTAACGGAGTACTGGCAGGCTTTCCAGTTGTTGATGTTCGTGCTGTGCTAGTA
GATGGATCTTACCATGATGTGGATTCAAGTGTTTTGGCATTCCAGCTGGCTGCTCGGGGAGCTTTTAGGGAAGGGATGAGAAAAGCTGGT
CCACAATTGCtAGTACCTTGCGAGGAATGACAAAGGGGCgTGCATCGTATGTTATGCAGTTAGCCAAATTTGACGTTGTCCCTCAACACA
TTXCAAAACCAGCTTGCCNAAAAGGAGGAAGCAGCTGCTGCTTAGTCAGTCATCTTCCAGATTTTGGATCCACAAACTTGAAAATAGGTA
TTTTTaCTCGACGAAGATGTTAAGGCTTGGACAACATTCTTTTTGTACGTACCAGCATGGAACACCGATGGAGAAXTAGCTGATATTXTA
GTCATGCGTCTGAGTTTTTTCAAACGTTTGTGTATGTTGGTGAATTATAAGCTGAAACTCCAAGAGACGGAAGAAACCCAGAAGGGAAAT
GGTATACTTGCATTTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan